KEGG   Escherichia coli DH1: EcDH1_0824
Entry
EcDH1_0824        CDS       T01996                                 

Definition
(GenBank) (2Fe-2S)-binding domain protein
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
edh  Escherichia coli DH1
Pathway
edh00230  Purine metabolism
edh01100  Metabolic pathways
edh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:edh00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    EcDH1_0824
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: ACX38508
Position
complement(879795..880274)
AA seq 159 aa
MNHSETITIECTINGMPFQLHAAPGTPLSELLREQGLLSVKQGCCVGECGACTVLVDGTA
IDSCLYLAAWAEGKEIRTLEGEAKGGKLSHVQQAYAKSGAVQCGFCTPGLIMATTAMLAK
PREKPLTITEIRRGLAGNLCRCTGYQMIVNTVLDCEKTK
NT seq 480 nt   +upstreamnt  +downstreamnt
atgaatcacagcgaaacaattaccatcgaatgcaccattaacgggatgccttttcagctt
cacgccgcaccaggcacgccgctctcggaattactccgcgaacaaggactgctaagtgtc
aaacaagggtgctgcgtgggtgaatgtggtgcctgtacggtgttggtcgacggcacagca
atagacagttgcttataccttgccgcctgggctgaaggaaaagagatccgcacgctggaa
ggtgaagcgaaaggcggaaaactttctcatgttcagcaggcttatgcgaaatccggcgca
gtgcagtgcgggttttgtacgcctggcctgattatggctaccacggcaatgctggcgaaa
ccacgcgagaagccattaaccattacggaaattcgtcgcggactggcgggaaatctttgt
cgctgcacggggtatcagatgattgtaaatacagttctggattgcgagaaaacgaagtaa

DBGET integrated database retrieval system