KEGG   Escherichia coli DH1: EcDH1_0871Help
Entry
EcDH1_0871        CDS       T01996                                 

Definition
(GenBank) exodeoxyribonuclease V, beta subunit
  KO
K03582  exodeoxyribonuclease V beta subunit [EC:3.1.11.5]
Organism
edh  Escherichia coli DH1
Pathway
edh03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:edh00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    EcDH1_0871
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:edh03400]
    EcDH1_0871
Enzymes [BR:edh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     EcDH1_0871
DNA repair and recombination proteins [BR:edh03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     EcDH1_0871
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UvrD-helicase UvrD_C AAA_19 UvrD_C_2 PDDEXK_1 AAA_30 AAA_11 Cas_Cas2CT1978
Motif
Other DBs
NCBI-ProteinID: ACX38554
Structure
PDB: 

Position
927760..931302
Genome map
AA seq 1180 aa AA seqDB search
MSDVAETLDPLRLPLQGERLIEASAGTGKTFTIAALYLRLLLGLGGSAAFPRPLTVEELL
VVTFTEAATAELRGRIRSNIHELRIACLRETTDNPLYERLLEEIDDKAQAAQWLLLAERQ
MDEAAVFTIHGFCQRMLNLNAFESGMLFEQQLIEDESLLRYQACADFWRRHCYPLPREIA
QVVFETWKGPQALLRDINRYLQGEAPVIKAPPPDDETLASRHAQIVARIDTVKQQWRDAV
GELDALIESSGIDRRKFNRSNQAKWIDKISAWAEEETNSYQLPESLEKFSQRFLEDRTKA
GGETPRHPLFEAIDQLLAEPLSIRDLVITRALAEIRETVAREKRRRGELGFDDMLSRLDS
ALRSESGEVLAAAIRTRFPVAMIDEFQDTDPQQYRIFRRIWHHQPETALLLIGDPKQAIY
AFRGADIFTYMKARSEVHAHYTLDTNWRSAPGMVNSVNKLFSQTDDAFMFREIPFIPVKS
AGKNQALRFVFKGETQPAMKMWLMEGESCGVGDYQSTMAQVCAAQIRDWLQAGQRGEALL
MNGDDARPVRASDISVLVRSRQEAAQVRDALTLLEIPSVYLSNRDSVFETLEAQEMLWLL
QAVMTPERENTLRSALATSMMGLNALDIETLNNDEHAWDVVVEEFDGYRQIWRKRGVMPM
LRALMSARNIAENLLATAGGERRLTDILHISELLQEAGTQLESEHALVRWLSQHILEPDS
NASSQQMRLESDKHLVQIVTIHKSKGLEYPLVWLPFITNFRVQEQAFYHDRHSFEAVLDL
NAAPESVDLAEAERLAEDLRLLYVALTRSVWHCSLGVAPLVRRRGDKKGDTDVHQSALGR
LLQKGEPQDAAGLRTCIEALCDDDIAWQTAQTGDNQPWQVNDVSTAELNAKTLQRLPGDN
WRVTSYSGLQQRGHGIAQDLMPRLDVDAAGVASVVEEPTLTPHQFPRGASPGTFLHSLFE
DLDFTQPVDPNWVREKLELGGFESQWEPVLTEWITAVLQAPLNETGVSLSQLSARNKQVE
MEFYLPISEPLIASQLDTLIRQFDPLSAGCPPLEFMQVRGMLKGFIDLVFRHEGRYYLLD
YKSNWLGEDSSAYTQQAMAAAMQAHRYDLQYQLYTLALHRYLRHRIADYDYEHHFGGVIY
LFLRGVDKEHPQQGIYTTRPNAGLIALMDEMFAGMTLEEA
NT seq 3543 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatgtcgccgagacactagatcctttgcgcttgcccttacagggtgagcgcctg
attgaagcctctgccggcacaggcaaaacctttacgattgcggcgctctatttgcgcctg
ttacttggactaggcggttccgccgcctttccccgcccgctgaccgttgaagaactgctg
gtggtcacctttaccgaggctgccacggcagaattgcgcggtcgtatccgtagcaatatc
cacgagttgcgcatcgcctgtctgcgtgaaaccaccgacaatccactgtacgaacgcctg
ctggaagagatcgacgataaagcgcaagccgcgcagtggttgttgttagccgaacggcag
atggatgaagcggcagtctttactattcacggcttttgccagcgcatgctcaacctgaat
gcctttgaatccggcatgctgtttgagcagcagctgattgaagatgagtctctgctacgc
taccaggcctgcgccgatttctggcgtcgccactgctacccgctgccgcgtgaaatagcc
caggtcgtctttgaaacctggaaagggccgcaggcgttgctgcgcgatattaatcgttat
ctgcaaggcgaagcgccggttatcaaagcaccgccgcccgatgatgaaacgctggcttcc
cgtcacgcgcaaattgtggcgcgtattgatacggtaaaacagcagtggcgcgacgcagtg
ggtgaactggatgcgctgatcgaatcttctggtattgatcgacgcaagtttaaccgtagc
aatcaggctaaatggatcgacaagatcagcgcctgggcagaagaagagacaaacagttat
cagttgccggagtcgctggaaaaattctcccagcgtttcttagaagatcgcacgaaggcc
gggggggaaaccccgcgacatccactgtttgaggcgatcgatcaactgcttgcagaacca
ttgtcgatccgcgatctggtgatcacccgcgcattggctgagatccgcgaaacagtagcg
cgtgaaaaacgccgccgtggcgaattgggttttgatgacatgttaagtcggctcgattcc
gcgctgcgtagcgaaagcggtgaggtgttggcagcggcgatccgtacgcgattcccggtg
gcaatgatcgatgaatttcaggataccgacccccagcagtaccgaatttttcgccgtatc
tggcaccatcagccggaaaccgcattgttgctaattggcgacccgaagcaggccatatat
gcattccggggtgcggatatcttcacttatatgaaggcgcgtagcgaagttcacgcccac
tacactttagacaccaactggcgttccgcaccaggaatggtgaacagcgtgaataagctt
ttcagccagactgatgacgcgttcatgtttcgcgaaataccgtttattccagtgaaatca
gccgggaaaaatcaggcgttacgttttgtatttaaaggtgaaacacagcctgcgatgaaa
atgtggctgatggaaggcgaaagctgcggcgttggcgattatcaaagtaccatggcgcag
gtatgtgctgcgcaaatccgcgactggctacaagccggacagcggggcgaagcgttgctg
atgaacggcgacgacgcgcgtccggtgcgtgcttcggacatcagtgtgctggtgcgcagc
cgccaggaggccgcccaggtgcgcgatgccttaacgttgctggaaatcccttccgtttac
ctttcgaaccgcgacagtgtttttgaaactctggaagcgcaggaaatgctttggttgttg
caggcggtgatgacgcccgaacgtgagaacaccctgcgtagtgcgctggcaacgtcaatg
atggggctgaacgcgctggatatcgaaacgctgaacaatgacgaacatgcgtgggatgtg
gtagtcgaagagttcgatggttatcggcaaatctggcgcaaacgtggcgttatgccgatg
ctgcgggcgctgatgtcggcgcgtaacattgctgaaaacttgctggcaacggcaggcggt
gagcggcgtcttaccgatatcttgcatatcagcgaactgctacaagaagccggaacgcag
ctggaaagtgaacatgcgctggtacgctggttatcgcaacatatcctcgagccagacagt
aatgcctccagccaacaaatgcgtctcgaaagtgataaacatctggtgcagattgtcacg
atccacaaatcgaaagggctggaatatccattggtctggctgccgtttatcaccaatttc
cgcgtccaggagcaggcgttttatcacgatcgccactcgtttgaggcagttctggatctt
aatgctgcgccagaaagcgtcgacctcgcggaggccgaacgtctggcggaagatctgcgt
ttgctttacgtggcgctgacacgttcggtttggcattgcagtctcggcgttgcaccgctg
gtgcgccgtcgtggcgataaaaaaggtgacaccgacgtccaccaaagtgcgctcgggcgt
ttgctgcaaaaaggggaaccgcaagatgcggcagggcttcgcacctgtattgaagcgtta
tgcgatgatgatattgcctggcaaacggcacaaactggtgataaccaaccctggcaggtt
aatgatgtttctacagcagagctgaatgcgaagacgttacaacgattgcccggcgataac
tggcgcgtcaccagctactctggtttgcaacagcgtggtcacggtatcgcccaggatttg
atgcctcggctggatgtcgatgctgcaggcgttgccagcgtcgttgaagaaccgacgtta
acaccacatcagtttccgcgcggtgcgtcaccggggacgttcttgcacagtttgtttgaa
gacctggattttacccagccggttgacccgaactgggtgcgggaaaaactggaactcggc
ggctttgaatcgcagtgggaaccggtattgaccgagtggatcacggctgtcctccaggca
cctctcaatgaaaccggcgtaagcctgagtcaactttccgcccgcaataaacaggtggag
atggagttttatctgccgattagtgaaccgcttatcgccagtcagcttgatacgttaatc
cgccagtttgacccgctatccgcaggctgcccgccgctggagttcatgcaggtacgtggc
atgttaaaaggctttatcgacctggtgttccgccacgaagggcgttattacctgctcgac
tataaatccaactggttgggtgaagacagttcggcttacacccaacaggctatggcagcg
gcaatgcaggcacaccgctatgatctgcaatatcagctttataccctggcgctgcatcgt
tatctgcgccatcgcattgctgattacgactatgagcaccactttggcggcgttatttat
ctgttcctgcgtggcgttgataaagaacatccgcaacaggggatttacacaacccgaccc
aacgccgggttgattgccctgatggatgagatgtttgccggtatgaccctggaggaggcg
taa

DBGET integrated database retrieval system