KEGG   Escherichia coli DH1: EcDH1_1919Help
Entry
EcDH1_1919        CDS       T01996                                 

Definition
(GenBank) 1-phosphofructokinase
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
edh  Escherichia coli DH1
Pathway
edh00010  Glycolysis / Gluconeogenesis
edh00030  Pentose phosphate pathway
edh00051  Fructose and mannose metabolism
edh00052  Galactose metabolism
edh00680  Methane metabolism
edh01100  Metabolic pathways
edh01110  Biosynthesis of secondary metabolites
edh01120  Microbial metabolism in diverse environments
edh01130  Biosynthesis of antibiotics
edh01200  Carbon metabolism
edh01230  Biosynthesis of amino acids
Module
edh_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:edh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EcDH1_1919
   00030 Pentose phosphate pathway
    EcDH1_1919
   00051 Fructose and mannose metabolism
    EcDH1_1919
   00052 Galactose metabolism
    EcDH1_1919
  Energy metabolism
   00680 Methane metabolism
    EcDH1_1919
Enzymes [BR:edh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     EcDH1_1919
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin DUF2617
Motif
Other DBs
NCBI-ProteinID: ACX39577
Structure
PDB: 

Position
complement(2071179..2072108)
Genome map
AA seq 309 aa AA seqDB search
MVRIYTLTLAPSLDSATITPQIYPEGKLRCTAPVFEPGGGGINVARAIAHLGGSATAIFP
AGGATGEHLVSLLADENVPVATVEAKDWTRQNLHVHVEASGEQYRFVMPGAALNEDEFRQ
LEEQVLEIESGAILVISGSLPPGVKLEKLTQLISAAQKQGIRCIVDSSGEALSAALAIGN
IELVKPNQKELSALVNRELTQPDDVRKAAQEIVNSGKAKRVVVSLGPQGALGVDSENCIQ
VVPPPVKSQSTVGAGDSMVGAMTLKLAENASLEEMVRFGVAAGSAATLNQGTRLCSHDDT
QKIYAYLSR
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggtacgtatctatacgttgacacttgcgccctctctcgatagcgcaacaattaccccg
caaatttatcccgaaggaaaactgcgctgtaccgcaccggtgttcgaacccgggggcggc
ggcatcaacgtcgcccgcgccattgcccatcttggaggcagtgccacagcgatcttcccg
gcgggtggcgcgaccggcgaacacctggtttcactgttggcggatgaaaatgtccccgtc
gctactgtagaagccaaagactggacccggcagaatttacacgtacatgtggaagcaagc
ggtgagcagtatcgttttgttatgccaggcgcggcattaaatgaagatgagtttcgccag
cttgaagagcaagttctggaaattgaatccggggccatcctggtcataagcggaagcctg
ccgccaggtgtgaagctggaaaaattaacccaactgatttccgctgcgcaaaaacaaggg
atccgctgcatcgtcgacagttctggcgaagcgttaagtgcagcactggcaattggtaac
atcgagttggttaagcctaaccaaaaagaactcagtgcgctggtgaatcgcgaactcacc
cagccggacgatgtccgcaaagccgcgcaggaaatcgttaatagcggcaaggccaaacgg
gttgtcgtttccctgggtccacaaggagcgctgggtgttgatagtgaaaactgtattcag
gtggtgccaccaccggtgaaaagccagagtaccgttggcgctggtgacagcatggtcggc
gcgatgacactgaaactggcagaaaatgcctctcttgaagagatggttcgttttggcgta
gctgcggggagtgcagccacactcaatcagggaacacgtctgtgctcccatgacgatacg
caaaaaatttacgcttacctttcccgctaa

DBGET integrated database retrieval system