KEGG   Escherichia coli DH1: EcDH1_2169Help
Entry
EcDH1_2169        CDS       T01996                                 

Definition
(GenBank) Alcohol dehydrogenase zinc-binding domain protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
edh  Escherichia coli DH1
Pathway
edh00010  Glycolysis / Gluconeogenesis
edh00071  Fatty acid degradation
edh00350  Tyrosine metabolism
edh00625  Chloroalkane and chloroalkene degradation
edh00626  Naphthalene degradation
edh01100  Metabolic pathways
edh01110  Biosynthesis of secondary metabolites
edh01120  Microbial metabolism in diverse environments
edh01130  Biosynthesis of antibiotics
edh01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:edh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EcDH1_2169
  Lipid metabolism
   00071 Fatty acid degradation
    EcDH1_2169
  Amino acid metabolism
   00350 Tyrosine metabolism
    EcDH1_2169
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    EcDH1_2169
   00626 Naphthalene degradation
    EcDH1_2169
Enzymes [BR:edh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     EcDH1_2169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 CoA_binding Methyltransf_25 2-Hacid_dh_C Methyltransf_31 Phage_holin_2_1 TrkA_N
Motif
Other DBs
NCBI-ProteinID: ACX39821
Structure
PDB: 

Position
2324640..2325650
Genome map
AA seq 336 aa AA seqDB search
MKAAVVTKDHHVDVTYKTLRSLKHGEALLKMECCGVCHTDLHVKNGDFGDKTGVILGHEG
IGVVAEVGPGVTSLKPGDRASVAWFYEGCGHCEYCNSGNETLCRSVKNAGYSVDGGMAEE
CIVVADYAVKVPDGLDSAAASSITCAGVTTYKAVKLSKIRPGQWIAIYGLGGLGNLALQY
AKNVFNAKVIAIDVNDEQLKLATEMGADLAINSHTEDAAKIVQEKTGGAHAAVVTAVAKA
AFNSAVDAVRAGGRVVAVGLPPESMSLDIPRLVLDGIEVVGSLVGTRQDLTEAFQFAAEG
KVVPKVALRPLADINTIFTEMEEGKIRGRMVIDFRH
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgcagttgttacgaaggatcatcatgttgacgttacgtataaaacactgcgc
tcactgaaacatggcgaagccctgctgaaaatggagtgttgtggtgtatgtcataccgat
cttcatgttaagaatggcgattttggtgacaaaaccggcgtaattctgggccatgaaggc
atcggtgtggtggcagaagtgggtccaggtgtcacctcattaaaaccaggcgatcgtgcc
agcgtggcgtggttctacgaaggatgcggtcattgcgaatactgtaacagtggtaacgaa
acgctctgccgttcagttaaaaatgccggatacagcgttgatggcgggatggcggaagag
tgcatcgtggtcgccgattacgcggtaaaagtgccagatggtctggactcggcggcggcc
agcagcattacctgtgcgggagtcaccacctacaaagccgttaagctgtcaaaaattcgt
ccagggcagtggattgctatctacggtcttggcggtctgggtaacctcgccctgcaatac
gcgaagaatgtctttaacgccaaagtgatcgccattgatgtcaatgatgagcagttaaaa
ctggcaaccgaaatgggcgcagatttagcgattaactcacacaccgaagacgccgccaaa
attgtgcaggagaaaactggtggcgctcacgctgcggtggtaacagcggtagctaaagct
gcgtttaactcggcagttgatgctgtccgtgcaggcggtcgtgttgtggctgtcggtcta
ccgccggagtctatgagcctggatatcccacgtcttgtgctggatggtattgaagtggtc
ggttcgctggtcggcacgcgccaggatttaactgaagccttccagtttgccgccgaaggt
aaagtggtgccgaaagtcgccctgcgtccgttagcggacatcaacaccatctttactgag
atggaagaaggcaaaatccgtggccgcatggtgattgatttccgtcactaa

DBGET integrated database retrieval system