KEGG   Escherichia coli DH1: EcDH1_3255Help
Entry
EcDH1_3255        CDS       T01996                                 

Definition
(GenBank) acetaldehyde dehydrogenase (acetylating)
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
edh  Escherichia coli DH1
Pathway
edh00360  Phenylalanine metabolism
edh00362  Benzoate degradation
edh00620  Pyruvate metabolism
edh00621  Dioxin degradation
edh00622  Xylene degradation
edh00650  Butanoate metabolism
edh01100  Metabolic pathways
edh01120  Microbial metabolism in diverse environments
edh01220  Degradation of aromatic compounds
Module
edh_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:edh00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    EcDH1_3255
   00650 Butanoate metabolism
    EcDH1_3255
  Amino acid metabolism
   00360 Phenylalanine metabolism
    EcDH1_3255
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EcDH1_3255
   00622 Xylene degradation
    EcDH1_3255
   00621 Dioxin degradation
    EcDH1_3255
Enzymes [BR:edh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     EcDH1_3255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh F420_oxidored GFO_IDH_MocA Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: ACX40879
Position
complement(3497084..3498034)
Genome map
AA seq 316 aa AA seqDB search
MSKRKVAIIGSGNIGTDLMIKILRHGQHLEMAVMVGIDPQSDGLARARRMGVATTHEGVI
GLMNMPEFADIDIVFDATSAGAHVKNDAALREAKPDIRLIDLTPAAIGPYCVPVVNLEAN
VDQLNVNMVTCGGQATIPMVAAVSRVARVHYAEIIASIASKSAGPGTRANIDEFTETTSR
AIEVVGGAAKGKAIIVLNPAEPPLMMRDTVYVLSDEASQDDIEASINEMAEAVQAYVPGY
RLKQRVQFEVIPQDKPVNLPGVGQFSGLKTAVWLEVEGAAHYLPAYAGNLDIMTSSALAT
AEKMAQSLARKAGEAA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagcgtaaagtcgccattatcggttctggcaacattggtaccgatctgatgatt
aaaattttgcgtcacggtcagcatctggagatggcggtgatggttggcattgatcctcag
tccgacggtctggcgcgcgccagacgtatgggcgtcgccaccacccatgaaggggtgatc
ggactgatgaacatgcctgaatttgctgatatcgacattgtatttgatgcgaccagcgcc
ggtgctcatgtgaaaaacgatgccgctttacgcgaagcgaaaccggatattcgcttaatt
gacctgacgcctgctgccatcggcccttactgcgtgccggtggttaacctcgaggcgaac
gtcgatcaactgaacgtcaacatggtcacctgcggcggccaggccaccattccaatggtg
gcggcagtttcacgcgtggcgcgtgttcattacgccgaaattatcgcttctatcgccagt
aaatctgccggacctggcacgcgtgccaatatcgatgaatttacggaaaccacttcccga
gccattgaagtggtgggcggcgcggcaaaagggaaggcgattattgtgcttaacccagca
gagccaccgttgatgatgcgtgacacggtgtatgtattgagcgacgaagcttcacaagat
gatatcgaagcctcaatcaatgaaatggctgaggcggtgcaggcttacgtaccgggttat
cgcctgaaacagcgcgtgcagtttgaagttatcccgcaggataaaccggtcaatttaccg
ggcgtggggcaattctccggactgaaaacagcggtctggctggaagtcgaaggcgcagcg
cattatctgcctgcctatgcgggcaacctcgacattatgacttccagtgcgctggcgaca
gcggaaaaaatggcccagtcactggcgcgcaaggcaggagaagcggcatga

DBGET integrated database retrieval system