KEGG   Escherichia coli DH1: EcDH1_3549Help
Entry
EcDH1_3549        CDS       T01996                                 

Definition
(GenBank) ApaG domain protein
  KO
K06195  ApaG protein
Organism
edh  Escherichia coli DH1
Brite
KEGG Orthology (KO) [BR:edh00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    EcDH1_3549
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: ACX41163
Position
3819771..3820148
Genome map
AA seq 125 aa AA seqDB search
MINSPRVCIQVQSVYIEAQSSPDNERYVFAYTVTIRNLGRAPVQLLGRYWLITNGNGRET
EVQGEGVVGVQPLIAPGEEYQYTSGAIIETPLGTMQGHYEMIDENGVPFSIDIPVFRLAV
PTLIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgatcaattcgccccgagtgtgtattcaggttcaaagcgtctacattgaggctcaatct
tcacctgataatgaacgttacgtttttgcttataccgtaaccatacgcaatctggggcga
gcgccagtgcagttgttggggcgttactggctgatcaccaatggcaatggccgtgaaacc
gaagtccagggcgaaggagtggttggcgtccagccacttatcgcgcctggcgaagagtac
cagtacaccagcggtgcaatcattgaaaccccgctgggcaccatgcagggtcactacgaa
atgatcgatgaaaatggcgtccctttcagcatcgacattcccgtattccgactcgccgtt
cccacactcattcattaa

DBGET integrated database retrieval system