KEGG   Entamoeba dispar: EDI_223820Help
Entry
EDI_223820        CDS       T01083                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1 precursor
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
edi  Entamoeba dispar
Pathway
edi00010  Glycolysis / Gluconeogenesis
edi00562  Inositol phosphate metabolism
edi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:edi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EDI_223820
   00562 Inositol phosphate metabolism
    EDI_223820
Enzymes [BR:edi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     EDI_223820
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     EDI_223820
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 GNAT_acetyltran tRNA_bind_3
Motif
Other DBs
NCBI-GeneID: 5885672
NCBI-ProteinID: XP_001733517
UniProt: B0EQX5
AA seq 448 aa AA seqDB search
MLAILVNMVLCCYGSDTDITHCLSTRTPYFPKRIRNPTLDHFTIVHTELVQRHGSRYPTA
NDINAMNKMADKFAENSKIIWKNPFPMKMEGELCERGKQELFSLGKYYKGEFKKLFYGKS
LTNINVTATFKKRTQDSALSWLEGFYDDEPKKKQMVIDYKINITVVPKDQDMQLYFHKNC
RRYVEHEKDYSTCKQSNQYAQMKLRETADRFMKAIGMTNTDESTSKNLTQIAFTAGAHEY
VVFNKSDGLLKYFNIKDAHIMEYIKDLETYYTKGMSNDLNYKIAIPLLDSIINGLKLAVT
KDKNSQLTEQDNNILGNFRFAHAETVTPLMTLMGINIDQFALTVKLNEAKKNQRNWNMSK
VSPYSVHLMFVLLKSNEGKYYVRTYFNQEVITXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXKRHLIFTNQHYEILKLCYYFYIC
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgctggccattttagtgaatatggtcctttgttgttatggtagtgacacagatataacc
cactgcctaagcacaagaacaccatactttcccaaacgcataagaaacccaacgctggac
catttcactatagttcacacagaactggtccagcgacatggttctcgatacccaacagca
aatgacataaatgcaatgaataaaatggctgataaatttgctgaaaattccaagattata
tggaaaaatccatttccaatgaaaatggaaggagaactatgcgaaagagggaaacaagaa
ctatttagtttgggaaagtattacaagggtgaatttaaaaagttattttatgggaagtct
ttaactaatattaacgttactgctacatttaaaaaaaggactcaagatagtgccttaagt
tggttagaagggttttatgatgacgaacctaaaaaaaaacaaatggttattgactacaaa
ataaatattactgttgtccctaaagatcaggacatgcagttgtacttccataaaaattgt
agaagatatgttgaacatgaaaaagattattcaacatgtaaacagtccaatcaatatgct
caaatgaaattaagagaaacagcagatagatttatgaaagcaattggaatgactaatact
gatgaaagcacaagtaaaaatcttacacaaattgctttcactgctggagcacatgaatat
gttgtgtttaataaaagtgatggattattaaaatattttaatattaaagatgcacacata
atggagtatattaaagatttagagacatactatacaaaaggtatgtctaatgatttaaat
tataaaattgcaatccctcttttagactctattattaatggactcaaattagcggttaca
aaagataaaaatagtcaattaacagaacaagacaataacattctaggtaattttagattt
gcacatgcagaaactgtgacacctttaatgactttaatgggaattaatatagatcaattt
gctttaactgttaaattaaatgaagcaaaaaagaatcagagaaattggaacatgtctaag
gttagtccatatagtgttcatcttatgtttgttcttctgaaatcaaatgagggaaaatat
tatgtaagaacttattttaatcaagaggttatcacnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnaaacgtcatttaatatttacgaatcaacattatgaaattttgaag
ttatgctattacttttatatttgttag

DBGET integrated database retrieval system