KEGG   Entamoeba dispar: EDI_340680Help
Entry
EDI_340680        CDS       T01083                                 

Definition
(RefSeq) dipeptidyl peptidase III
  KO
K01277  dipeptidyl-peptidase III [EC:3.4.14.4]
Organism
edi  Entamoeba dispar
Brite
KEGG Orthology (KO) [BR:edi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:edi01002]
    EDI_340680
Enzymes [BR:edi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.4  dipeptidyl-peptidase III
     EDI_340680
Peptidases [BR:edi01002]
 Metallo Peptidases
  Family M49: dipeptidyl-peptidase III family
   EDI_340680
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M49
Motif
Other DBs
NCBI-GeneID: 5883389
NCBI-ProteinID: XP_001738316
UniProt: B0EJD2
AA seq 645 aa AA seqDB search
MSLSVKTPLKFLDCTHAWEQLTPEEQIYIHYLNKANWASFPISVKQCSVEAYDIFVAFLK
MYKTISHTELLKKAEVSDNTKEQYEDYVSTFFANGGNYLSFGDKKFIPECSKEEFTTIIK
ASGHNYFESLIDIMYDVTPSLIHFGIPPEGCTAYYSSNITKEDIEHCNALLQKKGMLLEN
TRIDKINNKLIIGIASIEEREEEYEDVILKYGWCHSELEMLVNELKECEKLELVQRDKNK
KEMFKNYIQTFTSNYNLHKEAQRWWVRDQKPSVEFNVGFIETYEDPIGVRGEWEMFVAVV
DKEKTKELTELVQRANEILPSLPWGKVFEKDVFESPDFTSIDIVGFGTSGLPIGINLPNY
DDVRMEQFKNVSLSNVMACGSSQDNIPFISLEQQTLYKTCSPRALETQVALHELLGHGSG
KYLRCDNGKKNFPEDLINPLNGKKVKYYQDKMTYDTVFKSLGSAMEECRAETVGLFLTYN
PIVKEILKLSEDVQYINWLSEMRSGLTGLKFYNPETKSWGQAHCQARFALFKTVEKSGAV
EIIGENIVLHRELIPKGIEALKELLLKIQICRATADIEYAQSFFIPLSTPNEDELKFREI
VINKKIPRSGFIQCNTKMVDGKVKLITYEPSVEGMIQSFLDRYSF
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgtcattatcagttaaaactcctcttaaatttttagattgtactcatgcttgggaacaa
cttacacctgaagaacaaatttatatacattacttgaataaggctaattgggcatcattc
cctatttctgttaaacagtgttcagtagaagcgtatgacatttttgttgcatttttgaag
atgtacaaaactatctcacatacagaactattaaaaaaagcagaagtatcagacaataca
aaagaacaatatgaagattatgtttcaactttctttgctaatggaggaaattacttatct
tttggagataaaaagtttattcctgaatgtagcaaagaagaatttactactataattaaa
gcatctggacataattattttgaatctttaattgacattatgtatgacgtaactccaagt
cttattcattttggtattccacctgaaggatgcactgcttattactcttctaatattact
aaagaagatattgagcattgtaatgcattattacaaaagaaaggaatgttattagaaaat
acaagaattgataaaattaataataaattaataattggaattgcttctatagaagaaagg
gaagaagaatatgaagatgtaatattaaaatatggatggtgtcattctgagttagaaatg
ttagtaaatgaactaaaagaatgtgaaaaattagagttagttcaaagagataaaaacaaa
aaggaaatgtttaagaattatatccaaacatttactagtaactataaccttcataaagaa
gcacagagatggtgggtaagggatcaaaaaccatctgttgaatttaatgttggatttatt
gaaacttatgaagatcctattggagttcgtggtgaatgggagatgtttgttgcagtagta
gataaagagaaaacaaaagaattaactgaattggtgcaaagagcaaatgaaatattacca
tcacttccttggggcaaagtatttgagaaagatgtatttgaatcacctgattttacatca
attgatattgttggatttggaacttcaggacttccaattggaattaatttacctaattat
gatgacgttagaatggaacaatttaagaatgtatcattgtctaatgttatggcatgtggt
tctagccaagataatattcctttcataagtcttgaacaacaaacattatacaaaacatgt
tctcctcgtgccttagaaactcaagttgctttgcatgaacttcttggtcatggaagtgga
aaatatcttcgatgtgacaatggaaagaagaatttccctgaagaccttattaatcctttg
aatgggaaaaaagttaaatactatcaagataaaatgacctatgacacagtatttaaatca
cttggaagtgcaatggaagagtgtagggctgaaaccgttggattattcttgacatataat
ccaattgttaaagagatattaaaattgtctgaagatgttcaatacattaactggttatct
gaaatgagaagtggattaactggactaaaattctataatccagaaactaaaagttgggga
caagcacattgccaagcccgatttgcgttatttaaaacagttgaaaagagtggtgcggtt
gaaattattggagagaatattgtgttacacagagaattaattccaaaaggtattgaagca
ttgaaggaattattattaaaaattcaaatatgtagagcaacagctgatatagaatatgca
caatcatttttcattccattatctactccaaacgaagatgaattaaagtttagagaaatt
gtcattaataagaagattcctcgttctggttttatccaatgcaacactaaaatggttgat
ggtaaagttaaattaattacctatgaaccaagtgttgaaggaatgattcaatcattctta
gaccgttattcattttaa

DBGET integrated database retrieval system