KEGG   Entamoeba dispar: EDI_346820Help
Entry
EDI_346820        CDS       T01083                                 

Definition
(RefSeq) ATP-dependent RNA helicase HAS1
  KO
K13179  ATP-dependent RNA helicase DDX18/HAS1 [EC:3.6.4.13]
Organism
edi  Entamoeba dispar
Brite
KEGG Orthology (KO) [BR:edi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:edi03041]
    EDI_346820
   03009 Ribosome biogenesis [BR:edi03009]
    EDI_346820
Enzymes [BR:edi01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     EDI_346820
Spliceosome [BR:edi03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    EDI_346820
Ribosome biogenesis [BR:edi03009]
 Eukaryotic type
  90S particles
   Helicases
    EDI_346820
  Pre-60S particles
    EDI_346820
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4217 DEAD
Motif
Other DBs
NCBI-GeneID: 5885240
NCBI-ProteinID: XP_001740077
UniProt: B0EPM1
AA seq 522 aa AA seqDB search
MSNKDNIERIHKCGDKEAIEKEELIEERNIKINNEMYDIEEKIKKVIGKELEEMGITQFN
QIQQEIVPELNKGKNIIVECPAHKGISSTVIARSIYLSKSFKDIKEEDIEKTENGGPFII
IICGDYNEVISTREIIKNFVNINVSCWTGVKNKNKEKKGVMRKDGIIVTTLGSILYQIVN
NEEFKCPNLEFIGCTSMNKNEDMGIGKDYIKVFNRLPKCQVLLESNKKIDEDIIKSSIKK
GIKYKFEEEKKEEQEVGYVLYPLQRKNDIICTIAKNPKKKKIVLKFFSNEEAIFYQDIMS
RLNICEGIVLHTKMSIQEQREIIEKINNIEYCVVFTTQERIINKVDMGIFVDIPKDLDKV
EYKGAQEMLLMIPNSSKEFIEKIKEKRKVHQYGFEINELINIEEKLKKLVSKQYYVHLEA
RDAYRRFIQNYNTLKFGNIFQLSKLNLIDIAHTFGLENPTIVNTDLQGAQGVSEVPYEYK
RKIFIGKQATLPDFRIKGKSFSKKQTKRKLLKSKQHKDDEVQ
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgtctaataaagacaacatagaacgaattcataaatgtggagataaagaagctattgaa
aaagaagaattaattgaagaaagaaatattaaaataaataatgaaatgtatgatattgaa
gaaaaaataaaaaaagttattggaaaagaattagaagaaatgggtattactcaattcaat
caaattcaacaagaaattgttccagaattaaataaaggaaaaaatattatagtagaatgt
ccagcacataaaggaattagttcaacagttattgcaagaagtatttatttatctaaatca
tttaaagatattaaagaagaagatattgaaaaaacagaaaatggaggaccatttattatt
attatttgtggagattataatgaagtaattagtacaagggaaataattaaaaattttgta
aatattaatgttagttgttggacaggagttaagaataagaataaagaaaagaaaggagta
atgagaaaagatggaattattgtaactacattaggatcaatattatatcaaatagttaat
aatgaagaatttaaatgtccaaatttagaatttataggatgtacatcaatgaataaaaat
gaagatatgggaattggaaaagattatattaaagtatttaatagacttccaaaatgtcaa
gttttattagaatcaaataaaaaaatagatgaagatattattaaaagtagtattaaaaaa
ggaattaaatataaatttgaagaagaaaaaaaagaagaacaagaagttggatatgtatta
tatccattacaaagaaaaaatgatataatttgtacaattgctaaaaatcctaaaaaaaag
aaaattgttttaaaatttttttcaaatgaagaagctattttttatcaagatattatgagt
agattaaatatatgtgaaggaattgtattacatacaaaaatgtcaattcaagaacaaaga
gaaataattgaaaaaattaataatattgaatattgtgtagtttttactacacaagaaaga
ataattaataaagttgatatgggtatttttgtagatatacctaaagatcttgataaagtt
gaatataaaggagcacaagaaatgttattaatgattcctaattcatctaaagaatttata
gaaaaaattaaagaaaaaagaaaagttcatcaatatggatttgaaataaatgaattaatt
aatattgaagaaaaattaaaaaaacttgtaagtaaacaatattatgtacatttagaagca
agagatgcatatcgtagatttattcaaaattataatactttgaaatttggaaatattttt
caattatctaaattaaatctcattgatattgcacatacttttggattagaaaatccaact
attgttaacactgatcttcaaggtgcacaaggagttagtgaagtaccttatgaatataaa
agaaagatttttattggaaaacaagcaactcttccagattttagaataaaaggaaagagt
ttctcaaagaaacaaacaaaaagaaagttattaaaatcaaaacaacataaagatgatgag
gtacaatga

DBGET integrated database retrieval system