KEGG   Escherichia coli DH1: ECDH1ME8569_0339Help
Entry
ECDH1ME8569_0339  CDS       T02102                                 

Gene name
mhpE
Definition
(GenBank) 4-hydroxy-2-ketovalerate aldolase
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
edj  Escherichia coli DH1
Pathway
edj00360  Phenylalanine metabolism
edj00362  Benzoate degradation
edj00621  Dioxin degradation
edj00622  Xylene degradation
edj01100  Metabolic pathways
edj01120  Microbial metabolism in diverse environments
edj01220  Degradation of aromatic compounds
Module
edj_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:edj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    ECDH1ME8569_0339 (mhpE)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ECDH1ME8569_0339 (mhpE)
   00622 Xylene degradation
    ECDH1ME8569_0339 (mhpE)
   00621 Dioxin degradation
    ECDH1ME8569_0339 (mhpE)
Enzymes [BR:edj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     ECDH1ME8569_0339 (mhpE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm
Motif
Other DBs
NCBI-ProteinID: BAJ42195
Position
374292..375305
Genome map
AA seq 337 aa AA seqDB search
MNGKKLYISDVTLRDGMHAIRHQYSLENVRQIAKALDDARVDSIEVAHGDGLQGSSFNYG
FGAHSDLEWIEAAADVVKHAKIATLLLPGIGTIHDLKNAWQAGARVVRVATHCTEADVSA
QHIQYARELGMDTVGFLMMSHMTTPENLAKQAKLMEGYGATCIYVVDSGGAMNMSDIRDR
FRALKAELKPETQTGMHAHHNLSLGVANSIAAVEEGCDRIDASLAGMGAGAGNAPLEVFI
AAADKLGWQHGTDLYALMDAADDLVRPLQDRPVRVDRETLALGYAGVYSSFLRHCETAAA
RYGLSAVDILVELGKRRMVGGQEDMIVDVALDLRNNK
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaacggtaaaaaactttatatctcggacgtcacattgcgtgacggtatgcacgccatt
cgtcatcagtattcgctggaaaacgttcgccagattgccaaagcactggacgatgcccgc
gtggattcgattgaagtggcccacggcgacggtttgcaaggttccagctttaactatggt
ttcggcgcacatagcgaccttgaatggattgaagcggcggcggatgtggtgaagcacgcc
aaaatcgcgacgttgttgctgccaggaatcggcactattcacgatctgaaaaatgcctgg
caggctggcgcgcgggtggttcgtgtggcaacgcactgtaccgaagctgatgtttccgcc
cagcatattcagtatgcccgcgagctcggaatggacaccgttggttttctgatgatgagc
catatgaccacgccggagaatctcgccaagcaggcaaagctgatggaaggctacggtgcg
acctgtatttatgtggtggattctggcggtgcgatgaacatgagcgatatccgtgaccgt
ttccgcgccctgaaagcagagctgaaaccagaaacgcaaactggcatgcacgctcaccat
aacctgagtcttggcgtggcgaactctatcgcggcggtggaagagggctgcgaccgaatc
gacgccagcctcgcgggaatgggcgcgggcgcaggtaacgcaccgctggaagtgtttatt
gccgccgcggataaactgggctggcagcatgggaccgatctctatgcgttaatggatgcc
gccgacgacctggtgcgtccgttgcaggatcgaccggtacgagtcgatcgcgaaacgctg
gcgctgggatacgctggtgtttactcgagcttcctgcgtcactgtgaaacggcggcggcg
cgttatggcttaagtgcggtggatattctcgttgagctgggcaaacgccggatggttggc
ggccaggaggatatgatcgttgacgtggcgctggatctgcgcaacaacaaataa

DBGET integrated database retrieval system