KEGG   Escherichia coli DH1: ECDH1ME8569_0635Help
Entry
ECDH1ME8569_0635  CDS       T02102                                 

Gene name
nagA
Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
edj  Escherichia coli DH1
Pathway
edj00520  Amino sugar and nucleotide sugar metabolism
edj01100  Metabolic pathways
edj01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:edj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    ECDH1ME8569_0635 (nagA)
Enzymes [BR:edj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     ECDH1ME8569_0635 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: BAJ42491
Structure
PDB: 

Position
complement(691863..693011)
Genome map
AA seq 382 aa AA seqDB search
MYALTQGRIFTGHEFLDDHAVVIADGLIKSVCPVAELPPEIEQRSLNGAILSPGFIDVQL
NGCGGVQFNDTAEAVSVETLEIMQKANEKSGCTNYLPTLITTSDELMKQGVRVMREYLAK
HPNQALGLHLEGPWLNLVKKGTHNPNFVRKPDAALVDFLCENADVITKVTLAPEMVPAEV
ISKLANAGIVVSAGHSNATLKEAKAGFRAGITFATHLYNAMPYITGREPGLAGAILDEAD
IYCGIIADGLHVDYANIRNAKRLKGDKLCLVTDATAPAGANIEQFIFAGKTIYYRNGLCV
DENGTLSGSSLTMIEGVRNLVEHCGIALDEVLRMATLYPARAIGVEKRLGTLAAGKVANL
TAFTPDFKITKTIVNGNEVVTQ
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgtatgcattaacccagggccggatctttaccggccacgaatttcttgatgaccacgcg
gttgttatcgctgatggcctgattaaaagcgtctgtccggtagcggaactgccgccagag
atcgaacaacgttcactgaacggggccattctctcccccggttttatcgatgtgcagtta
aacggctgcggcggcgtacagtttaacgacaccgctgaagcggtcagcgtggaaacgctg
gaaatcatgcagaaagccaatgagaaatcaggctgtactaactatctgccgacgcttatc
accaccagcgatgagctgatgaaacagggcgtgcgcgttatgcgcgagtacctggcaaaa
catccgaatcaggcgttaggtctgcatctggaaggtccgtggctgaatctggtaaaaaaa
ggcacccataatccgaattttgtgcgtaagcctgatgccgcgctggtcgatttcctgtgt
gaaaacgccgacgtcattaccaaagtgaccctggcaccggaaatggttcctgcggaagtc
atcagcaaactggcaaatgccgggattgtggtttctgccggtcactccaacgcgacgttg
aaagaagcaaaagccggtttccgcgcggggattacctttgccacccatctgtacaacgcg
atgccgtatattaccggtcgtgaacctggcctggcgggcgcgatcctcgacgaagctgac
atttattgcggtattattgctgatggcctgcatgttgattacgccaacattcgcaacgct
aaacgtctgaaaggcgacaaactgtgtctggttactgacgccaccgcgccagcaggtgcc
aacattgaacagttcatttttgcgggtaaaacaatatactaccgtaacggactttgtgtg
gatgagaacggtacgttaagcggttcatccttaaccatgattgaaggcgtgcgtaatctg
gtcgaacattgcggtatcgcactggatgaagtgctacgtatggcgacgctctatccggcg
cgtgcgattggcgttgagaaacgtctcggcacactcgccgcaggtaaagtagccaacctg
actgcattcacacctgattttaaaatcaccaagaccatcgttaacggtaacgaggtcgta
actcaataa

DBGET integrated database retrieval system