KEGG   Escherichia coli DH1: ECDH1ME8569_0681Help
Entry
ECDH1ME8569_0681  CDS       T02102                                 

Gene name
sdhD
Definition
(GenBank) sdhD
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
edj  Escherichia coli DH1
Pathway
edj00020  Citrate cycle (TCA cycle)
edj00190  Oxidative phosphorylation
edj00650  Butanoate metabolism
edj01100  Metabolic pathways
edj01110  Biosynthesis of secondary metabolites
edj01120  Microbial metabolism in diverse environments
edj01130  Biosynthesis of antibiotics
edj01200  Carbon metabolism
Module
edj_M00009  Citrate cycle (TCA cycle, Krebs cycle)
edj_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
edj_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:edj00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ECDH1ME8569_0681 (sdhD)
   00650 Butanoate metabolism
    ECDH1ME8569_0681 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    ECDH1ME8569_0681 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: BAJ42537
Structure
PDB: 

Position
744553..744900
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFFASAFTKVF
TLLALFSILIHAWIGMWQVLTDYVKPLALRLMLQLVIVVALVVYVIYGFVVVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcctccgcattaggacgcaatggcgtacatgatttcatcctcgttcgc
gctaccgctatcgtcctgacgctctacatcatttatatggtcggttttttcgctaccagt
ggcgagctgacatatgaagtctggatcggtttcttcgcctctgcgttcaccaaagtgttc
accctgctggcgctgttttctatcttgatccatgcctggatcggcatgtggcaggtgttg
accgactacgttaaaccgctggctttgcgcctgatgctgcaactggtgattgtcgttgca
ctggtggtttacgtgatttatggattcgttgtggtgtggggtgtgtga

DBGET integrated database retrieval system