KEGG   Escherichia coli DH1: ECDH1ME8569_2771
Entry
ECDH1ME8569_2771  CDS       T02102                                 

Gene name
xdhC
Definition
(GenBank) xanthine dehydrogenase iron-sulfur-binding subunit
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
edj  Escherichia coli DH1
Pathway
edj00230  Purine metabolism
edj01100  Metabolic pathways
edj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:edj00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    ECDH1ME8569_2771 (xdhC)
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: BAJ44627
Position
2981396..2981875
AA seq 159 aa
MNHSETITIECTINGMPFQLHAAPGTPLSELLREQGLLSVKQGCCVGECGACTVLVDGTA
IDSCLYLAAWAEGKEIRTLEGEAKGGKLSHVQQAYAKSGAVQCGFCTPGLIMATTAMLAK
PREKPLTITEIRRGLAGNLCRCTGYQMIVNTVLDCEKTK
NT seq 480 nt   +upstreamnt  +downstreamnt
atgaatcacagcgaaacaattaccatcgaatgcaccattaacgggatgccttttcagctt
cacgccgcaccaggcacgccgctctcggaattactccgcgaacaaggactgctaagtgtc
aaacaagggtgctgcgtgggtgaatgtggtgcctgtacggtgttggtcgacggcacagca
atagacagttgcttataccttgccgcctgggctgaaggaaaagagatccgcacgctggaa
ggtgaagcgaaaggcggaaaactttctcatgttcagcaggcttatgcgaaatccggcgca
gtgcagtgcgggttttgtacgcctggcctgattatggctaccacggcaatgctggcgaaa
ccacgcgagaagccattaaccattacggaaattcgtcgcggactggcgggaaatctttgt
cgctgcacggggtatcagatgattgtaaatacagttctggattgcgagaaaacgaagtaa

DBGET integrated database retrieval system