KEGG   Edwardsiella sp. LADL05-105: AAZ33_02785
Entry
AAZ33_02785       CDS       T04005                                 

Definition
(GenBank) xanthine dehydrogenase
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
edl  Edwardsiella sp. LADL05-105
Pathway
edl00230  Purine metabolism
edl01100  Metabolic pathways
edl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:edl00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    AAZ33_02785
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: AKR76806
Position
complement(612622..613107)
AA seq 161 aa
MNVKEWVEITCQINGKTYQFCVSPAMSLLEMLREHGLTSVKQGCSVGECGACSVLIDGVA
TDSCLYLALWADGKQIVTADGLGRADSLSPIQQAYVDAGAVQCGFCTPGLVVATHALLAK
PRSRPLTHQEIRRGLSGNLCRCTGYQAIVRAVDLCQREEDQ
NT seq 486 nt   +upstreamnt  +downstreamnt
atgaatgtcaaagaatgggttgaaatcacctgccagatcaatgggaaaacctatcagttt
tgcgtgtcgccggcgatgtcgctgctggaaatgctgcgcgagcacgggctaaccagcgtg
aagcagggctgcagtgtcggtgagtgcggcgcctgcagcgtattgatcgatggcgtggca
accgacagctgcctgtacctggcgctgtgggccgacggtaagcagatcgtcacggccgat
gggctgggccgagccgacagcctttcgccgatccagcaggcctatgtcgacgccggcgca
gtgcagtgtggtttctgtaccccgggactggtggtcgcgacccatgccctgctggcgaaa
ccgcgcagtcgcccgctgacgcaccaggagatccgccgcggcctctccggcaacctgtgc
cgttgcaccggctatcaggccatcgtacgcgccgtcgatctctgccagcgcgaggaagat
cagtag

DBGET integrated database retrieval system