KEGG   Edwardsiella sp. LADL05-105: AAZ33_07535Help
Entry
AAZ33_07535       CDS       T04005                                 

Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
edl  Edwardsiella sp. LADL05-105
Pathway
edl00030  Pentose phosphate pathway
edl00480  Glutathione metabolism
edl01100  Metabolic pathways
edl01110  Biosynthesis of secondary metabolites
edl01120  Microbial metabolism in diverse environments
edl01130  Biosynthesis of antibiotics
edl01200  Carbon metabolism
Module
edl_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
edl_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
edl_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:edl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AAZ33_07535
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AAZ33_07535
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:edl04147]
    AAZ33_07535
Enzymes [BR:edl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     AAZ33_07535
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     AAZ33_07535
Exosome [BR:edl04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   AAZ33_07535
  Exosomal proteins of colorectal cancer cells
   AAZ33_07535
  Exosomal proteins of bladder cancer cells
   AAZ33_07535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N HetR_C
Motif
Other DBs
NCBI-ProteinID: AKR77549
Position
1671667..1673139
Genome map
AA seq 490 aa AA seqDB search
MAVTSTAQACDLIIFGAKGDLARRKLLPSLYQLEKAGHIHPETRIIGVGRAEWDATAYRK
VVREALDTFLKEPLDDALWQRLSDRLDFCNLDVNDTEQFQRLAERVAPQQRVTINYFAMP
PSTFGAICQGLGHAGMNLQPSRIVMEKPLGTDLASSRAINDQVARYFDENQVYRIDHYLG
KETVLNLLALRFANALFANNWDNSMIDHVQITVAEEVGIEGRWGYFDQAGQMRDMVQNHL
LQILTMIAMDPPADLSTDRIRDEKVKVLRSLRRINHGNVRETTVRGQYTAGFVQGKKVPG
YLEEEGANKCSNTETFIAIRVDIDNWRWAGVPFYLRTGKRLPSKCSEVVIYFKNPPLNLF
SDSYQALPQNKLTIRLQPDEGVQIDILNKVPGLEHKHRLQTTKLDLSFSDTFHQEHLADA
YERLLLEAMRGIQALFVRRDEVEEAWKWVDSIMTAWADDNDAPKPYQAGTWGPVSSVALI
TRDGRCWNEF
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggcggtaacgtcaacggcacaggcttgcgacctgattatttttggcgccaagggcgat
ctggcccggcgcaaactgctgccttccctgtatcagctggaaaaggccggccacattcac
cccgagacgcgcattatcggcgtcggacgcgccgagtgggatgccacggcttaccgtaag
gtggttcgggaggcgctggatacctttttgaaagagccgctggacgatgcgctgtggcag
cgtctgagcgaccgcctcgacttttgcaacctggacgtcaacgatactgagcagttccag
cgtctggcggagagggtggcgccgcagcagcgggtgactattaactattttgccatgccg
ccaagcacctttggcgcgatttgccaggggctggggcatgcggggatgaaccttcagccc
agccgtatcgtcatggagaagccgctggggaccgatctggcctcatcgcgagcgatcaac
gatcaggtggcgcgctattttgatgagaaccaggtgtaccgtatcgaccactacctgggt
aaggagacggtgctgaatctactggcgctgcgctttgccaacgcgctgtttgccaataac
tgggataatagcatgatcgaccacgtgcagatcaccgtggcggaagaggtcggtatcgaa
gggcgctggggatatttcgatcaggccgggcagatgcgtgacatggtgcagaaccacctg
ctgcagatcctgaccatgatcgccatggatccgccggcggacctctccaccgaccgtatt
cgtgatgaaaaggtcaaggtgctgcgttccctgcgccgaatcaaccacggcaacgtgcgt
gagacgacggtgcgcggccagtacaccgccggtttcgtgcagggaaagaaggtgccggga
tacctggaggaggagggggcgaacaagtgcagcaatacagaaacctttatcgccattcgc
gtcgatatcgacaactggcgctgggccggggtgccgttttacctgcgtaccggtaagcgc
ctgccgagcaagtgttctgaggtggttatctatttcaaaaacccgccgctgaacctgttc
agcgactcctatcaggcgctgccgcagaataagctaaccattcgtctgcagccggacgaa
ggggtacagatcgatatcctgaataaggtgccggggctggagcataaacaccgcctgcag
accaccaagctggatctgagcttctccgataccttccaccaggagcatctggcggacgcc
tatgagcgcctgctgctggaggcgatgcgcggcattcaggcgctgtttgtccgccgcgat
gaggtggaggaggcctggaagtgggtcgactccatcatgacggcctgggccgacgacaac
gacgcgccgaagccttatcaggcgggtacctgggggccggtgtcatcggtggcgctgatc
acccgtgacgggcgttgctggaacgaattctga

DBGET integrated database retrieval system