KEGG   Edwardsiella sp. LADL05-105: AAZ33_07820Help
Entry
AAZ33_07820       CDS       T04005                                 

Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04072  acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
edl  Edwardsiella sp. LADL05-105
Pathway
edl00010  Glycolysis / Gluconeogenesis
edl00071  Fatty acid degradation
edl00350  Tyrosine metabolism
edl00620  Pyruvate metabolism
edl00625  Chloroalkane and chloroalkene degradation
edl00626  Naphthalene degradation
edl00650  Butanoate metabolism
edl01100  Metabolic pathways
edl01110  Biosynthesis of secondary metabolites
edl01120  Microbial metabolism in diverse environments
edl01130  Biosynthesis of antibiotics
edl01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:edl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AAZ33_07820
   00620 Pyruvate metabolism
    AAZ33_07820
   00650 Butanoate metabolism
    AAZ33_07820
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AAZ33_07820
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    AAZ33_07820
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AAZ33_07820
   00626 Naphthalene degradation
    AAZ33_07820
Enzymes [BR:edl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AAZ33_07820
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     AAZ33_07820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Aldedh Fe-ADH_2 HTH_AsnC-type
Motif
Other DBs
NCBI-ProteinID: AKR77593
Position
complement(1728738..1731410)
Genome map
AA seq 890 aa AA seqDB search
MAVTNTAELDALVARVKKAQREFANFSQEQVDKIFRAAALAAADARIPLAKMAVAESGMG
IVEDKVIKNHFASEYIYNAYKDEKTCGILSEDDTFGTITIAEPTGLICGIVPTTNPTSTA
IFKALISLKTRNGIIFSPHPRAKQATNKAADIVLQAAIAAGAPKDIIGWIDEPSVELSNA
LMHHPDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVIDETADIKRAVASILMSKTF
DNGVICASEQSVIVVDSVYDKVRERFATHGGYLLQGKELKAVQDIILKNGALNAAIVGQP
AEKIAEMAGISVPAGTKILIGEVSVVDDSEPFAHEKLSPTLAMYRAKNFEDAVEKAEKLV
AMGGIGHTSCLYTDQDNQGARVNYFGEKMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGALPIALEEVATDGAK
RAFIVTDRFLFNNGYADQVTNVLKAHGIETEVFFEVEADPTLSIVRKGAEQMNSFKPDVI
IALGGGSPMDAAKIMWVMYEHPETHFEELALRFMDIRKRIYKFPKMGVKAKMIAITTTSG
TGSEVTPFAVVTDDATGQKYPLADYALTPDMAIVDANLVMNMPKSLCAFGGLDAVTHALE
AYVSVLANEYSDGQALQALKLLKEFLPASYAEGAKNPVARERVHNAATIAGIAFANAFLG
VCHSMAHKLGSEFHIPHGLANALLISNVIRYNANDNPTKQTAFSQYDRPQARRRYAEIAD
HLGLSAPGDRTAQKIEKLLAWLESIKAELGIPASIREAGVQEADFLAKVDKLSEDAFDDQ
CTGANPRYPLIAELKQILLDTYYGREFVEHAQEESKAVAAPKAEKKAKKA
NT seq 2673 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaaccaacactgctgaactcgatgcgctggtcgcccgtgtcaaaaaagcccaa
cgcgagtttgccaacttctctcaggaacaggtagacaaaatcttccgcgccgccgcgctg
gccgctgccgatgcccgtattccgctggctaaaatggccgtcgctgaatccggtatgggt
atcgtggaagacaaggtgatcaaaaaccactttgcctccgaatatatctacaacgcctat
aaagatgaaaagacctgcggtatcttgtccgaagacgataccttcggcaccatcaccatc
gctgagccgaccggtctgatctgcggcatcgtaccgaccaccaacccgacctccaccgcg
atcttcaaggcgctgatcagcctgaagacccgcaacggcatcatcttctccccgcatccg
cgtgccaagcaggcgaccaacaaagccgccgatatcgtgctgcaggcggccatcgccgct
ggcgcgccgaaagacatcatcggctggatcgatgaaccctccgtcgagctgtctaacgcg
ctgatgcaccatccggacatcaacctgatcctggccaccggtggcccgggcatggtgaaa
gcggcctatagctccggcaagccggccatcggcgttggtgcgggcaacaccccggtggtg
atcgacgaaaccgcggatatcaaacgcgccgtcgcctccatcctgatgtccaaaaccttc
gacaacggcgtcatctgtgcctccgagcagtcagttatcgtcgtcgactccgtctacgac
aaagtgcgtgagcgttttgctacccacggcggctacctgctgcagggtaaagagctgaaa
gccgttcaggatatcatcctgaagaatggcgcgctgaacgccgccatcgtaggccagccg
gcagagaagatcgccgaaatggcaggcatcagcgtaccggcggggactaagatcctgatc
ggcgaagtcagcgtcgttgacgactccgagccgttcgcacacgaaaaactgtctccgacc
ctggcgatgtaccgtgccaaaaacttcgaggacgccgtagagaaagccgagaagctggtt
gccatgggcggtatcggccatacctcctgcctgtacaccgaccaggataaccagggcgcg
cgcgtaaactacttcggcgagaagatgaagaccgcccgtatcctgatcaataccccggcc
tcgcaaggggggatcggtgacctgtacaacttcaagctggcgccttccctgacgctgggc
tgcggctcctggggcggtaactccatctctgaaaacgtgggtccaaagcacctgatcaac
aagaaaacggtagcgaagcgagcagaaaacatgttgtggcataaacttccgaagtctatc
tacttccgccgcggcgccctgccgatcgcgctggaagaagtggcaaccgacggtgccaag
cgcgcctttatcgtcaccgaccgtttcctgttcaacaacggttatgccgaccaggttacc
aacgtactgaaagcgcacggtatcgaaaccgaagtcttcttcgaagttgaagccgaccca
accctgagcatcgtgcgcaaaggcgccgagcagatgaactccttcaagccggacgtgatc
atcgcgctgggcggcggctccccgatggatgcagccaagatcatgtgggtgatgtacgag
catccggaaacccacttcgaagagctggcgctgcgctttatggatatccgtaagcgtatc
tataagttcccgaaaatgggcgtcaaagccaaaatgatcgccatcaccaccacctctggc
accggctctgaagtcacgccgttcgccgtagtgaccgacgatgcgaccgggcagaaatac
ccgctggctgactatgcgctgaccccggacatggccatcgttgatgccaacctggtgatg
aacatgccgaaatccctgtgcgccttcggcggtctggatgcggtaacccatgcgctggaa
gcctacgtttccgttctggccaacgaatactctgacggccaggcgctgcaggccctgaag
ctgctgaaagagttcctgccggccagctatgccgaaggcgccaaaaacccggtagcccgt
gagcgtgtacacaacgccgctactatcgccggcatcgcgtttgccaacgccttcctcggg
gtatgtcactccatggcccacaaactgggctccgagttccatattccgcacggtctggcc
aacgccctgctgatctctaacgttattcgctacaacgcgaacgacaacccgaccaagcag
accgcatttagccagtacgaccgtccgcaggcgcgtcgccgttacgctgaaatcgctgac
catctgggtctgagcgcaccgggcgaccgcaccgcgcagaagatcgagaagctgctggcc
tggctggaaagcatcaaggctgagctgggtatcccggcctccatccgcgaagccggcgta
caggaagccgacttcctggcgaaagtggacaagctgtccgaagatgctttcgacgatcag
tgcaccggcgccaacccgcgctatccgctgattgccgagctcaagcaaattctgctggac
acctactatggccgcgagtttgtcgagcacgcgcaggaagagagcaaggccgtcgccgcg
ccgaaagcggaaaagaaggccaaaaaagcctga

DBGET integrated database retrieval system