KEGG   Edwardsiella sp. LADL05-105: AAZ33_10250Help
Entry
AAZ33_10250       CDS       T04005                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
edl  Edwardsiella sp. LADL05-105
Pathway
edl00071  Fatty acid degradation
edl00072  Synthesis and degradation of ketone bodies
edl00280  Valine, leucine and isoleucine degradation
edl00310  Lysine degradation
edl00380  Tryptophan metabolism
edl00620  Pyruvate metabolism
edl00630  Glyoxylate and dicarboxylate metabolism
edl00640  Propanoate metabolism
edl00650  Butanoate metabolism
edl00900  Terpenoid backbone biosynthesis
edl01100  Metabolic pathways
edl01110  Biosynthesis of secondary metabolites
edl01120  Microbial metabolism in diverse environments
edl01130  Biosynthesis of antibiotics
edl01200  Carbon metabolism
edl01212  Fatty acid metabolism
edl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:edl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AAZ33_10250
   00630 Glyoxylate and dicarboxylate metabolism
    AAZ33_10250
   00640 Propanoate metabolism
    AAZ33_10250
   00650 Butanoate metabolism
    AAZ33_10250
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AAZ33_10250
   00072 Synthesis and degradation of ketone bodies
    AAZ33_10250
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AAZ33_10250
   00310 Lysine degradation
    AAZ33_10250
   00380 Tryptophan metabolism
    AAZ33_10250
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AAZ33_10250
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AAZ33_10250
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AAZ33_10250
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:edl04147]
    AAZ33_10250
Enzymes [BR:edl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AAZ33_10250
Exosome [BR:edl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AAZ33_10250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AKR77968
Position
2296899..2298083
Genome map
AA seq 394 aa AA seqDB search
MKNCVIVSAVRTAIGSFNGALSQMGAVDLGATVIRAALERARLDPQRVDEVIMGNVLQAG
LGQNPARQALLRAGLSEAVCGFTVNKVCGSGLKSVALAAQAIQAGQALALVAGGMENMSQ
APYLLSAKARWGYRLGDGTLTDVILQDGLLCATHGYPMGITAENIAREYGISREMQDALA
LHSQQKAARALQRGAFQAEIVPVSVTSRKKTTLVERDEFPKADSTAEGLSTLRPAFDKAG
SVTAGNASGINDGAAALVVMEESAARAAGLTPLARIKGYASAGVAPALMGMGPVPAAQKA
LRQCGLQIADIDLIEANEAFAAQFLAVGKTLGLDAEKVNVNGGAIALGHPIGASGARILV
TLLHALAARDKTLGLATLCIGGGQGIALIVERIG
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattgtgtcatcgtcagcgcggtacgcaccgccatcggcagcttcaacggcgcc
ctgtctcagatgggtgccgtcgatctgggtgccacggtcatcagggccgccctggaacgc
gcccgcctcgacccgcagcgggtggatgaggtgatcatgggcaacgtgctgcaggccggc
ctggggcaaaacccggcgcgccaggcgctgctgcgggccggcctcagcgaggcggtctgc
ggttttaccgtcaacaaggtctgcggatcggggcttaagagcgtggcgctggccgcccag
gccattcaggcggggcaggcgctggcgctggtcgccggcggcatggaaaacatgagtcag
gcgccgtacctgctgagtgcaaaggcgcgctggggctaccgcctcggcgacggcacgctg
accgacgtcatcctgcaggatggtctgctgtgcgccacccacggctacccgatggggatc
accgccgaaaacatcgcccgcgaatacggcatcagccgtgagatgcaggacgcgctggcc
ctgcactcccagcaaaaggcggcccgcgccctccagcgcggcgcgtttcaggccgagatc
gtcccggtcagcgtgacatcgcgtaaaaaaaccaccctcgttgagcgcgacgaattcccc
aaagccgactccacggcggaagggctttccaccctgcgcccggcgttcgataaagccggc
agcgtcaccgccggcaacgcctcggggatcaacgacggcgcggcggcgctggtggtgatg
gaggaaagcgccgcccgggcggcggggctgacgccgctggcgcggattaagggctatgcc
agcgccggcgtcgcgccggcgctgatggggatggggccggtccccgccgcccagaaggcg
ctgcgccagtgtgggctgcagatagccgacatcgatctgatcgaggccaatgaagccttt
gccgcgcaattcctggccgtcggcaagacgctggggctggatgccgagaaggtgaacgtc
aacggcggcgccatcgcgctgggtcaccccatcggcgccagcggcgcccggatcctggtc
accctgctgcacgcgctcgccgcccgagacaaaaccctggggctggcgacgctgtgcatc
ggcggcggccaggggatcgccctgatcgtggagaggatcggctaa

DBGET integrated database retrieval system