KEGG   Edwardsiella sp. LADL05-105: AAZ33_17080Help
Entry
AAZ33_17080       CDS       T04005                                 

Definition
(GenBank) nucleotidase
  KO
K20881  5'-nucleotidase [EC:3.1.3.5]
Organism
edl  Edwardsiella sp. LADL05-105
Pathway
edl00230  Purine metabolism
edl00240  Pyrimidine metabolism
edl00760  Nicotinate and nicotinamide metabolism
edl01100  Metabolic pathways
edl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:edl00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    AAZ33_17080
   00240 Pyrimidine metabolism
    AAZ33_17080
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    AAZ33_17080
Enzymes [BR:edl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     AAZ33_17080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase HAD
Motif
Other DBs
NCBI-ProteinID: AKR79043
Position
3832875..3833567
Genome map
AA seq 230 aa AA seqDB search
MVPTLDWNDIDTVLLDMDGTLIDLAFDNYFWLTLVPQTLSETRGISRADAQALILREYQA
VLNWYCFDYWRERLGLDIHRMTLEQGARVRVRQDTLPFLDALRASGRRTILLTNAHPHGL
AMKMAQTGLDSHLDILYSTHRFGYPKEDQRLWRAVQHQCGLDPARTLFIDDAEPILDAAH
QFGIRYCLGVSNPDSGRPEKRFARHPAMSDYRALLPAITAGGPENDRRAQ
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggttcccaccctcgactggaatgacatcgacaccgtcctgctggatatggacggcacg
ctgatcgatctggcctttgacaactacttttggctaacgctggtaccgcagaccttaagc
gagacgcgcggcatttcccgcgccgatgctcaggcgctgatcctgcgggagtaccaggcg
gtactaaactggtactgtttcgactactggcgtgagcgcctggggctggatattcaccgc
atgacccttgagcagggcgcgcgggtacgggtgcgtcaggatacgctgccgttcctggat
gccctgcgcgccagcgggcgccgtaccattctgctgaccaacgcccacccgcacgggttg
gcgatgaagatggcgcagaccgggctggatagccaccttgatatactctattccacccac
cgctttggctatcccaaagaggatcagcgcctgtggcgagcggtacagcatcagtgcggg
ctggatccagccagaacgctgtttattgacgatgccgaaccgatcctcgacgccgcgcac
cagttcggtatccgctactgcctgggcgtcagtaatcccgactccggtaggccggaaaaa
cgctttgcccgccatccggcgatgagcgactaccgcgccctactgccggccatcaccgcc
ggtgggcccgagaacgacaggagggcacaatga

DBGET integrated database retrieval system