KEGG   Enterococcus durans: LIU_06210Help
Entry
LIU_06210         CDS       T04048                                 

Definition
(GenBank) 3-hydroxy-3-methylglutaryl-CoA reductase
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
edu  Enterococcus durans
Pathway
edu00900  Terpenoid backbone biosynthesis
edu01110  Biosynthesis of secondary metabolites
edu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:edu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LIU_06210
Enzymes [BR:edu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     LIU_06210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-ProteinID: AKZ49329
Position
1301953..1303260
Genome map
AA seq 435 aa AA seqDB search
MGLAVLLEANQEKAGSFNEKKKFYQLTPEERRSQLVRGGVISKESADQLKNERLSEDIAN
HLIENQISQVEIPMGVAQNFQINGEKKWVPMATEEPSVIAAASNGAKICGNITAKTPQRL
MRGQIVLTGKSEYQAIIEAIDTRKDELFLCANNSYPSIVKRGGGVRDISTREFMGSDHAY
VSIDFLIDVKDAMGANIVNAILEGVASQLRSWFPDEEILFSILSNLATESLATACCTIPF
EYLGKSKEAGRQVAEKIQQAAEYAKLDVYRAATHNKGIMNGIEAVILATGNDTRAASAAI
HAYASRNGFYQGLTDWKIVDGQLVGKLTVPLAVATVGGASKILPKAKLALEILDVSSAKE
LAQVIAAVGLAQNLAALKALVTEGIQKGHMSLQARALAITVGATGDEIEQVASYLRKADT
MNQQLASDYLLETRS
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
ctgggactagcagtcttacttgaggcaaatcaagaaaaagcaggatcattcaacgaaaaa
aaaaagttttatcagctgacaccagaagaacgtaggagtcagttagttcgcggaggcgtg
atttctaaagaaagcgcggatcaactaaaaaatgaacgcttgtctgaagacattgcgaat
catttgattgagaatcaaataagccaagtggagattcctatgggtgttgcgcaaaatttc
cagatcaatggtgaaaaaaagtgggttcccatggcaacagaagaaccatccgtgatagca
gcagctagcaatggagcgaaaatttgtgggaatatcactgcaaaaacgccacaaagactg
atgagaggccagatcgtgttgacaggtaagtctgaatatcaggcaatcatcgaagcaata
gacacacgaaaagatgaactgtttttgtgtgcaaacaatagttatccctccattgttaaa
cgcggtggtggagtgagagatatttctacgagagaattcatgggaagtgaccatgcctat
gtatcaatcgatttcttgatcgatgtcaaagatgccatgggggcgaatatcgtcaatgcg
attttagaaggagtcgccagccaattgagaagctggttcccagatgaagagattttattc
agtattttgagtaacttagcaaccgaatctcttgctacagcatgttgcacgattcctttt
gaatatttaggtaaaagcaaagaagctggaagacaagttgccgaaaagatccaacaggca
gcggaatatgcaaagctagatgtttatcgggcagcaacgcataataaaggtatcatgaat
ggaatcgaagcggtcatcttagcaactggtaatgataccagagcggcatccgcagctatt
catgcatatgcttcaagaaatggcttttaccaagggttgacagattggaagatagttgat
ggacagttagtgggtaaattgactgtacctttagctgttgcgaccgtaggaggtgcttca
aagattttacctaaagcgaaacttgcgcttgaaatacttgatgtctcttctgcaaaagaa
ttggcacaagtaattgcggctgtgggcttagctcagaatttagcggcattgaaagcttta
gtaacagaaggcatccaaaaggggcatatgtccttacaagcacgagcattagccattact
gttggtgcaactggggatgaaatcgaacaagttgcgtcatatttaaggaaagcagatacc
atgaatcaacagcttgcaagtgattatttgctagaaacccgttcttga

DBGET integrated database retrieval system