KEGG   Enterococcus durans: LIU_06575Help
Entry
LIU_06575         CDS       T04048                                 

Gene name
gid
Definition
(GenBank) tRNA (uracil-5-)-methyltransferase
  KO
K04094  methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase [EC:2.1.1.74]
Organism
edu  Enterococcus durans
Brite
KEGG Orthology (KO) [BR:edu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:edu03016]
    LIU_06575 (gid)
   03036 Chromosome and associated proteins [BR:edu03036]
    LIU_06575 (gid)
Enzymes [BR:edu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.74  methylenetetrahydrofolate---tRNA-(uracil54-C5)-methyltransferase (FADH2-oxidizing)
     LIU_06575 (gid)
Transfer RNA biogenesis [BR:edu03016]
 Prokaryotic type
  tRNA modification factors
   Methyltransferases
    LIU_06575 (gid)
Chromosome and associated proteins [BR:edu03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    LIU_06575 (gid)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GIDA Pyr_redox_2 NAD_binding_8 3HCDH_N DAO AlaDh_PNT_C FAD_binding_2 FAD_binding_3 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: AKZ48093
UniProt: A0A377L2N3
Position
1377031..1378353
Genome map
AA seq 440 aa AA seqDB search
MKTVNVVGAGLAGSEAAWQIAQAGVPVRLYEMRPVKSTEAHHTSNFAELVCSNSLRGNSL
ANAVGLLKEEMRRLNSVVITSADETAVPAGGALAVDRDSFSETITRKVKEHPLVTVVNEE
ITAIPEGITIIATGPLTSHPLAESIKEFNGSEGFYFYDAAAPIVDKATIDMDKVYLKSRY
NKGEAAYLNCPMTEEEFKAFHEVLTTAEVAELKSFEKEKYFDGCMPIEVMAQRGFKTMLF
GPMKPVGLEDPKTGKRPYAVIQLRQDNAAASLYNIVGFQTHLKWGEQKRVFRMIPGLENA
EFVRYGVMHRNSFMNSPELLKPTYQSTKREDLFFAGQMTGVEGYVESAASGLLAGINAAR
LAKAEEPIEFPQETAIGSMAYYITHAEGKHFQPMNANYGLFPELPKRIRDKKTRYETIAQ
RALEVGEQFKRELFEEVPAN
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaactgttaatgttgtaggagcaggtcttgctggaagtgaagctgcgtggcagatt
gcgcaagcaggagtccctgttcgtttatatgaaatgcgtccagtaaaatcaactgaggca
catcacacaagtaattttgctgaactagtctgttccaactctctaagaggcaatagtcta
gcaaatgcggtcggtttgttgaaagaagaaatgcgtcgtttgaattccgtagtcattact
tcagctgatgaaacagctgttcctgctggaggagctttagcggttgaccgtgattccttt
tctgaaaccattacgcgaaaagtcaaagaacatcctttggtcacagtcgtcaacgaagaa
ataactgccataccagagggcatcacgatcattgcgacaggtccgttgacttctcatcct
ttggcggaaagtattaaagaattcaatggatcagaaggattttacttttatgatgcggct
gcgccaatcgtcgataaagcaacgatcgacatggacaaagtctacttgaaatctcgctac
aacaaaggggaagcagcttatttaaactgtccaatgacagaagaagagttcaaggctttt
catgaagtattaacgacagcagaagtggccgagttgaaatcttttgaaaaagaaaaatac
tttgacggctgtatgccgatcgaagtgatggcacaaagaggcttcaaaacaatgctgttt
ggtcctatgaagccagttggattagaagatccaaaaacgggcaaaagaccgtatgcagtc
attcagctacgccaagataatgcggcagcatctttgtataatatcgtcggttttcaaacg
catttgaagtggggcgaacaaaaacgtgttttccggatgatccctggattagaaaatgct
gagttcgtgcgttatggtgtgatgcaccgtaacagtttcatgaattcgccagaattattg
aagcctacgtatcaatcgacaaaacgcgaagatttatttttcgccggacaaatgacgggt
gtcgaagggtatgttgaaagtgccgccagtggtctacttgcaggtatcaatgccgctcgt
ttggcaaaagctgaagagccaattgaatttccacaagaaactgctatcggcagcatggca
tactatatcacacacgcagaaggcaaacatttccaaccgatgaatgcaaactatggattg
ttccctgagttaccgaaacgtattcgtgataaaaaaacacgttatgaaacaattgctcaa
agagcattggaagtgggcgaacaattcaaacgtgaattatttgaagaagttcctgccaat
tag

DBGET integrated database retrieval system