KEGG   Edwardsiella sp. EA181011: QY76_02715Help
Entry
QY76_02715        CDS       T03991                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
edw  Edwardsiella sp. EA181011
Pathway
edw00051  Fructose and mannose metabolism
edw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:edw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    QY76_02715
Enzymes [BR:edw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     QY76_02715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh ApbA UPF0052 DUF3387 F420_oxidored Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: AKM46392
Position
598764..599921
Genome map
AA seq 385 aa AA seqDB search
MKAIHFGAGNIGRGFIGKLLADANAELTFADVNQPLIDQLAHQQSYEVHVVGEQQRVERV
QHVSAIHSASPDAIAQIAHADIITTAVGPQVLNRLSATLAQGLLERHRIGNAQPLNIIAC
ENMVRGTSQLKQHVMAILPTALHPWVNQQIGFVDSAVDRIVPPSDAANDDPLDVTVETFS
EWIVDSTQFKGELPVIAGMEPTANLMAYVERKLFTLNTGHAITAYLGCLAGYRTIREAIL
DPAIRSNVKAAMEESGAVLIRRYGFDPQQHHAYIEKILSRFENPYLRDDVERVGRQPLRK
LGAMDRLTKPLRGTLEYALPHRHLLIGIAAALCYRNAHDPQAQEMAQQIAHLGVETALNQ
FAQLEDYPQVTSAVAKVYRTLRHKA
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaattcattttggtgcaggtaatattgggcgtggctttatcggtaaactgctg
gcagatgccaatgccgagctgaccttcgccgacgtcaatcagccattgatcgatcagttg
gctcatcagcaaagctacgaggtccatgtcgtcggcgagcaacaacgtgtcgagcgggta
cagcatgtcagcgccatccacagcgccagccccgatgcgatcgcgcaaatcgcccacgcc
gatatcatcaccaccgccgtcggcccacaggtattgaaccggctctccgccaccctagcg
caagggttgcttgagcgtcatcgcatcggcaatgcgcagccgctcaatatcatcgcctgt
gagaatatggtacgcggcaccagccaactgaaacagcacgtcatggccattctaccaacg
gcgctacacccctgggtaaaccagcagatcggcttcgtcgactccgccgtggatcgcatc
gtgccgcccagcgacgccgccaacgacgatcccttggacgtcacagtggaaaccttcagc
gaatggatcgtcgatagcacgcagttcaagggcgagctaccggttatcgctggcatggag
ccaacagccaatctgatggcctatgtcgagcgaaagctattcactctcaataccggccac
gccatcaccgcctatctgggctgcttggcgggttatcgcaccatccgcgaggcgatcctt
gaccccgcgatccgcagcaacgtcaaggcggctatggaggagagtggcgcggtactgatc
cgtcgctatggcttcgaccctcagcaacaccacgcctatattgaaaaaatcctctcccgc
ttcgaaaacccttatctgcgggacgacgtcgagcgcgtcgggcgccagcctttgcgtaag
ctgggggcgatggatcgtttaaccaagccgttgcgtggaactctagaatacgccttacca
catcgtcacctgctgatcgggattgccgccgccttatgttaccgcaatgcacacgatccc
caggcacaagagatggcgcaacagatcgcgcacctcggcgttgagacagcgttaaaccaa
ttcgctcagttggaggattatcctcaggtcacctcggcggtagcaaaggtatatcgaacc
ctgcgacataaggcataa

DBGET integrated database retrieval system