KEGG   Edwardsiella sp. EA181011: QY76_03095Help
Entry
QY76_03095        CDS       T03991                                 

Definition
(GenBank) alpha-D-glucose-1-phosphatase
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
edw  Edwardsiella sp. EA181011
Pathway
edw00010  Glycolysis / Gluconeogenesis
edw01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:edw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    QY76_03095
Enzymes [BR:edw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     QY76_03095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like HAD Acid_PPase SHOCT PNK3P
Motif
Other DBs
NCBI-ProteinID: AKM46455
Position
684679..685266
Genome map
AA seq 195 aa AA seqDB search
MLYIFDLGNVIVDIDFHRVLGVWSRYSGAPLATLSKRFTMGDTFRQHERGAIDDETFAQR
LCDEMGISLSFAQFELGWQAIFVALRPEVIDIMQRLRRQGERVVVLSNTNRLHTHFWPQH
YPEIAAACDKMYLSQELGMRKPDAEIYRYVLEQERAAAGESVFFDDNADNVAAAKALGIQ
AVQVCDRQVIPTYFA
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgctgtacatctttgatttaggtaacgtgattgtagacatcgattttcaccgtgtgctg
ggggtttggagccggtacagcggcgccccgctggccaccttaagcaagcgttttacgatg
ggcgatacctttcgtcagcatgagcgcggggcgatagacgatgaaacttttgcccagcgt
ctgtgcgatgaaatggggatctccctcagctttgcccagttcgagctgggctggcaggcg
attttcgtcgcgctgcgcccggaggtgatcgatatcatgcagcgcctgcgccgtcagggg
gagcgggtcgtggtgctctccaataccaatcggctgcacactcacttttggcctcagcac
tacccggagatcgcggccgcctgcgataaaatgtacctgtcgcaggagctgggcatgcgt
aaacccgatgccgaaatctatcgctatgtcctggagcaggagcgggcggcggccggggag
tcggtcttttttgacgataacgccgacaatgtggcggcggcgaaggcgttggggatccag
gcggtacaggtatgtgaccgtcaggtgatccccacctattttgcataa

DBGET integrated database retrieval system