KEGG   Edwardsiella sp. EA181011: QY76_04345Help
Entry
QY76_04345        CDS       T03991                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
edw  Edwardsiella sp. EA181011
Pathway
edw03010  Ribosome
Brite
KEGG Orthology (KO) [BR:edw00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    QY76_04345
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:edw03011]
    QY76_04345
Ribosome [BR:edw03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    QY76_04345
  Bacteria
    QY76_04345
  Archaea
    QY76_04345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AKM46677
Position
962732..963064
Genome map
AA seq 110 aa AA seqDB search
METIAKHCHARSSAQKVRLVADLIRGKKVSQALEVLTYTNKKAAVLVKKVLESAIANAEH
NDGADIDDLKVSKIFVDEGPTMKRIMPRAKGRADRILKRTSHITVVVSDR
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaaactattgctaagcattgccatgctcgctcttctgctcagaaggttcgcctggtg
gctgacctgatccgcggtaagaaagtgtcacaggctctggaagttctgacctacaccaac
aagaaagcggctgtactggtcaaaaaggttctggaatctgccattgctaacgcagaacac
aacgatggcgctgacatcgatgatctgaaagtatccaagatcttcgtcgacgaaggcccg
accatgaagcgcatcatgccgcgtgcaaaaggtcgcgctgatcgtatcctgaagcgcacc
agccacattactgtggttgtgtccgatcgctga

DBGET integrated database retrieval system