KEGG   Edwardsiella sp. EA181011: QY76_06315Help
Entry
QY76_06315        CDS       T03991                                 

Definition
(GenBank) nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
edw  Edwardsiella sp. EA181011
Pathway
edw00230  Purine metabolism
edw00240  Pyrimidine metabolism
edw01100  Metabolic pathways
edw01110  Biosynthesis of secondary metabolites
edw01130  Biosynthesis of antibiotics
Module
edw_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
edw_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
edw_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
edw_M00053  Pyrimidine deoxyribonuleotide biosynthesis, CDP/CTP => dCDP/dCTP,dTDP/dTTP
Brite
KEGG Orthology (KO) [BR:edw00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    QY76_06315
   00240 Pyrimidine metabolism
    QY76_06315
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:edw04131]
    QY76_06315
Enzymes [BR:edw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     QY76_06315
Membrane trafficking [BR:edw04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    QY76_06315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: AKM47000
Position
1417766..1418197
Genome map
AA seq 143 aa AA seqDB search
MTLERTFSIVKPNAVAKNAIGVIYARFESAGLKIVAAKMVHLTREQAEGFYAEHRGRPFF
DGLVTFMTSGPIMVQVLEGNDAVRRNREIMGATNPENALAGTLRADYADSLTENAVHGSD
SPASAEREIAYFFSAGDLCPRTR
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgaccttagaacgtaccttttccatcgtaaaaccgaacgcagtggccaaaaatgccatc
ggcgtcatctacgcacgctttgagtctgctggcctgaagatcgtcgccgccaaaatggtg
cacctgacgcgcgagcaggcggaaggcttttacgccgagcaccgcgggcgccccttcttt
gacggcctggtgaccttcatgacctccggcccgatcatggtgcaggtgctggagggtaac
gatgcggtgcgccgtaaccgtgagatcatgggagccacgaatccagaaaacgcgctggcc
ggtacgctgcgcgcagactatgccgatagcctgacggagaacgcggtgcacggctctgac
tctccggcctctgccgaacgcgaaatcgcctatttcttcagcgccggcgacctctgcccg
cgcacccgctga

DBGET integrated database retrieval system