KEGG   Edwardsiella sp. EA181011: QY76_07615Help
Entry
QY76_07615        CDS       T03991                                 

Definition
(GenBank) succinyl-CoA synthetase subunit alpha
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
edw  Edwardsiella sp. EA181011
Pathway
edw00020  Citrate cycle (TCA cycle)
edw00640  Propanoate metabolism
edw00660  C5-Branched dibasic acid metabolism
edw01100  Metabolic pathways
edw01110  Biosynthesis of secondary metabolites
edw01120  Microbial metabolism in diverse environments
edw01130  Biosynthesis of antibiotics
edw01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:edw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    QY76_07615
   00640 Propanoate metabolism
    QY76_07615
   00660 C5-Branched dibasic acid metabolism
    QY76_07615
Enzymes [BR:edw01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     QY76_07615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-ProteinID: AKM47212
Position
1718083..1718955
Genome map
AA seq 290 aa AA seqDB search
MSILINHETRVICQGFTGSQGTFHSEQALAYGTRLVGGVTPGKGGSEHLGLPVFNTVHEA
VSATGANASVIYVPAPFCKDSILEAIDGGISLIICITEGIPTQDMLVIRAKLDQSPGVRM
IGPNCPGVITPGACKIGIMPGHIHQPGRIGIVSRSGTLTYEAVKQTSDVGLGQSTCVGIG
GDPIPGSSFIDILALFQADPQTEAIVMIGEIGGNAEEEAAAYIKAHVTKPVIGYIAGVTA
PKGKRMGHAGAIIAGGKGTADEKFAALEAAGVVTVRSLADIGQAALRALA
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatactgatcaatcatgaaacccgggtcatctgccagggctttaccggcagccag
gggacattccactccgagcaggcgctggcctacggtacccgcctggtgggcggggtaacg
ccgggcaaggggggcagcgagcatctcggcctgccggtattcaacaccgtgcacgaggcg
gtctcggcgaccggcgccaacgccagcgtgatctatgtccctgcgccgttctgtaaagac
tccattctggaggcgatagacggcggtatttcgctgattatctgtattaccgaggggatc
ccgacgcaggatatgctggtgatccgggccaagctggatcagagccctggggtgcggatg
atcggcccgaactgtccgggggtgatcacgccgggcgcctgtaagatcggcattatgccg
gggcatatccaccaaccggggcgtatcgggatcgtttcccgttcgggaacattgacctac
gaggcggtgaagcagaccagcgacgtcgggctggggcagtccacctgcgtcggtatcggc
ggcgatccgatccccggctccagctttatcgacattctggcgctgttccaggccgacccg
cagaccgaggccatcgtgatgatcggcgagatcggcggcaacgcggaggaggaggcggcg
gcctatatcaaggcgcatgtgaccaagccggtgatcggctatatcgccggggtgacggcg
cccaagggtaagcgaatgggccatgccggggcgattatcgccggcggcaagggcaccgcg
gatgagaagtttgccgccctggaggccgcaggggtcgtcacggtgcgcagcctggccgat
atcggtcaggctgcgctgcgggctctggcctga

DBGET integrated database retrieval system