KEGG   Edwardsiella sp. EA181011: QY76_10190Help
Entry
QY76_10190        CDS       T03991                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
edw  Edwardsiella sp. EA181011
Pathway
edw00071  Fatty acid degradation
edw00072  Synthesis and degradation of ketone bodies
edw00280  Valine, leucine and isoleucine degradation
edw00310  Lysine degradation
edw00380  Tryptophan metabolism
edw00620  Pyruvate metabolism
edw00630  Glyoxylate and dicarboxylate metabolism
edw00640  Propanoate metabolism
edw00650  Butanoate metabolism
edw00900  Terpenoid backbone biosynthesis
edw01100  Metabolic pathways
edw01110  Biosynthesis of secondary metabolites
edw01120  Microbial metabolism in diverse environments
edw01130  Biosynthesis of antibiotics
edw01200  Carbon metabolism
edw01212  Fatty acid metabolism
edw02020  Two-component system
Brite
KEGG Orthology (KO) [BR:edw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    QY76_10190
   00630 Glyoxylate and dicarboxylate metabolism
    QY76_10190
   00640 Propanoate metabolism
    QY76_10190
   00650 Butanoate metabolism
    QY76_10190
  09103 Lipid metabolism
   00071 Fatty acid degradation
    QY76_10190
   00072 Synthesis and degradation of ketone bodies
    QY76_10190
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    QY76_10190
   00310 Lysine degradation
    QY76_10190
   00380 Tryptophan metabolism
    QY76_10190
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    QY76_10190
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    QY76_10190
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    QY76_10190
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:edw04147]
    QY76_10190
Enzymes [BR:edw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     QY76_10190
Exosome [BR:edw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   QY76_10190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AKM47657
Position
complement(2309904..2311088)
Genome map
AA seq 394 aa AA seqDB search
MKNCVIVSAVRTAIGSFNGALSQMGAVDLGATVIRAALERARLDPQRVDEVIMGNVLQAG
LGQNPARQALLRAGLSEAVCGFTVNKVCGSGLKSVALAAQAIQAGQAQALVAGGMENMSQ
APYLLSAKARWGYRLGDGTLTDVILQDGLLCATHGYPMGITAENIAREYGISREMQDALA
LHSQQKAARALQRGAFQAEIVPVSVTSRKKTTLFERDEFPKADSTAEGLSTLRPAFDKAG
SVTAGNASGINDGAAALVVMEESAARAAGLTPLARIKGYASAGVAPALMGMGPVPAAQKA
LRQCGLQIADIDLIEANEAFAAQFLAVGKTLGLDAEKVNVNGGAIALGHPIGASGARILV
TLLHALAARDKTLGLATLCIGGGQGIALIVERIG
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattgtgtcatcgtcagcgcggtacgcaccgccatcggcagcttcaacggcgcc
ctgtctcagatgggtgccgtcgatctgggtgccacggtcatcagggccgccctggaacgc
gcccgcctcgacccgcagcgggtggatgaggtgatcatgggcaacgtgctgcaggccggc
ctggggcaaaacccggcgcgccaggcgctgctgcgggccggcctcagcgaggcggtttgc
ggttttaccgtcaacaaggtctgcggatcggggcttaagagcgtggcgctggccgcccag
gccattcaggcggggcaagcgcaggcgctggtcgccggcggcatggaaaacatgagtcag
gcgccgtacctgctgagtgcaaaggcgcgctggggctaccgcctcggcgacggcacgctg
accgacgtcatcctgcaggatggtctgctgtgcgccacccacggctacccgatggggatc
accgccgaaaacatcgcccgcgaatacggcatcagccgtgagatgcaggacgcgctggcc
ctgcactcccagcaaaaggcggcccgcgccctccagcgcggcgcgtttcaagccgagatc
gtcccggtcagcgtgacatcgcgtaaaaaaaccaccctctttgagcgcgacgaattccct
aaagccgactccacggcggaagggctttccaccctgcgcccggcgttcgataaagccggc
agcgtcaccgccggcaacgcctcggggatcaacgacggcgcggcggcgctggtggtgatg
gaggaaagcgccgcccgggcggcggggctgacgccgctggcgcggattaagggctatgcc
agcgcgggcgtcgcgccggcgctgatggggatggggccggtccccgccgcccagaaggcg
ctgcgccagtgtgggctgcagatagccgacatcgatctgatcgaggccaatgaagccttt
gccgcgcagttcctggccgtcggcaagacgctggggctggatgccgagaaggtcaacgtc
aacggcggcgccatcgcgctgggtcaccccatcggcgccagcggcgcccggatcctggtc
accctgctgcacgcgctcgccgcccgggacaaaaccctggggctggcgacgctgtgcatc
ggcggcggccaggggatcgccctgatcgtggagaggatcggctaa

DBGET integrated database retrieval system