KEGG   Edwardsiella sp. EA181011: QY76_12175Help
Entry
QY76_12175        CDS       T03991                                 

Definition
(GenBank) 23S rRNA methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
edw  Edwardsiella sp. EA181011
Brite
KEGG Orthology (KO) [BR:edw00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:edw03009]
    QY76_12175
Enzymes [BR:edw01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     QY76_12175
Ribosome biogenesis [BR:edw03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    QY76_12175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_31 Methyltransf_23 Methyltransf_12 Pox_MCEL Methyltransf_9 MTS PrmA Methyltransf_32 TPMT CMAS MetW PCMT Ubie_methyltran
Motif
Other DBs
NCBI-ProteinID: AKM47982
Position
complement(2783913..2784716)
Genome map
AA seq 267 aa AA seqDB search
MPYQCPLCHSPLCHDAHQWCCVNNHRFDCAKEGYVNLMPVQFKHSRQPGDSSEMMQARRA
FLQADHYLPLRDAVQGLLARYLPGDGCNVLDIGCGEGYYTAHWVGVRGAQVYGLDIAKVA
IRYAARRYPQVHFCVASSLRLPFADASIGGVVRIYAPCNAQELARVVVTGGCLVTVTPAE
RHLYQMKALVYPEVHLHAQKAETLPGFTLVDCQRLGYAMTLNGSEAAALLQMTPFAWRAP
QGVAEALQARAAFECETDFLIRVYRRD
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgccgtaccaatgtcccctgtgccactcaccgctgtgccacgatgcgcaccagtggtgc
tgcgttaacaaccatcgctttgactgcgctaaagagggatatgtcaatctgatgccggtg
cagtttaaacactcgcgtcagccaggcgacagcagtgagatgatgcaggcccgcagggcc
tttttgcaggcggaccattacctgccgctgcgcgacgccgtacagggcctgctagcgcgt
tatttacccggtgacggctgtaacgtcctggacatcggctgtggcgaggggtattacacc
gcccactgggtcggtgtgcggggggcgcaggtctatggactggatatcgccaaggtggcc
attcgctatgcggcgcggcgctatccgcaggttcacttctgcgtggcgtccagtctgcgc
ctgccgttcgccgatgccagcatcggcggtgtggtacgcatctacgcgccgtgcaatgct
caggagctggcgcgagtggtggtgacgggcggctgtctggtgaccgtgacgccggcggaa
cgccatctgtatcagatgaaagcgttggtctaccccgaggtgcatctgcatgcgcagaag
gcggagacgctgccgggctttaccctggtcgattgccagcgcctgggctatgccatgaca
ctgaacgggagcgaggcggccgcgttgctgcagatgacgccctttgcctggcgggcgccg
cagggggttgcagaggcgctgcaggcgcgcgcggcgtttgagtgtgagactgacttcctg
atccgggtttaccgccgcgactga

DBGET integrated database retrieval system