KEGG   Edwardsiella sp. EA181011: QY76_17285Help
Entry
QY76_17285        CDS       T03991                                 

Gene name
apaG
Definition
(GenBank) heavy metal transporter
  KO
K06195  ApaG protein
Organism
edw  Edwardsiella sp. EA181011
Brite
KEGG Orthology (KO) [BR:edw00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    QY76_17285 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AKM48823
Position
3912515..3912892
Genome map
AA seq 125 aa AA seqDB search
MIDAPRIIVQVQSVYAGSQSLPEEARFVFAYTVTLRNLGRFNVQLLRRYWLITNGNGRQT
EVQGEGVIGEQPLILPNGEFQYTSGAIIETPCGTMEGHYEMVDHQGHTFRIAIPVFRLAI
PSLIN
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatgcaccccgtatcatcgttcaggtacagagtgtctatgccggatcgcagtcg
ctgcctgaagaggcgcgcttcgtctttgcctataccgtcactctgcgtaatctgggccgc
tttaacgtacagctcctgcgccgctactggctaataaccaacggcaacggccgccagact
gaagtccagggcgaaggggtcatcggcgaacagccgctgatcctgcccaacggcgagttt
cagtacaccagcggcgccatcatcgaaacgccctgcggtaccatggaggggcactacgaa
atggttgaccatcaaggacacaccttccgtatcgccattccggtcttccgcctggccatt
cccagcctgattaactga

DBGET integrated database retrieval system