KEGG   Edwardsiella sp. EA181011: QY76_17325
Entry
QY76_17325        CDS       T03991                                 

Definition
(GenBank) xanthine dehydrogenase
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
edw  Edwardsiella sp. EA181011
Pathway
edw00230  Purine metabolism
edw01100  Metabolic pathways
edw01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:edw00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    QY76_17325
Enzymes [BR:edw01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     QY76_17325
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: AKM48830
Position
3922155..3924446
AA seq 763 aa
MSLGSPLRRVDAEAKVTGQARYTDDMMMPGMLHACYVRSRIAHGNVTAIDTREAESMPGV
EAVFTFHDVPSAPFPTAGHAWSLEPGKRDIADRHLLTGHVRHFGDGVAIVVARDLLSAER
AAARVQVSYDALPVITRPQAALADGAPAIHPGGNLLRHSEIDAGEPEARIAAADLQLEGH
YETPVVQHCHMEGVTCYAYMEQPDHIVIVSSTQIPQIVRRTVAQALGLPWSHVRVIKPYV
GGGFGNKQDVLEEPMAAFLTQRLGGKPVKVSLSREECFVATRTRHAFSIDARLGMRRDGL
LEGYRLTVLSNTGAYASHGHSIAAAGANKISYLYPRSAFGYCADTVYTNLPAAGAMRGYG
APQVDFALECLMDDAAARLDLDPLEVRLRNVARQGDRNPVNGKSIYSAGLTECLEKGRRL
FEWDRRRAECMAQSADAPVRRGVGVACFSYGSNTYPVGVEIAGARLLLNQDGTVNLQIGA
TEIGQGSDTVFAQMASETLGIPFKQIRVISTQDTDITAFDPGAFASRQSYVAAPAIRRAA
EIMRQKILAHAALISHQPEWGLTLCDGNVVMAMQPDQVLMSVADVAMQAYYHQEIGAQIL
AEVSHKTTTNPPAFGCTFVDLSIDIALCQVTINRILNLHDSGRILNPQLAEGQVHGGMGM
GIGWALFEEMIIDEKSGVVRNPNLLDYKFPTCVDLPDLECAFVETVEPQSAYGHKALGEP
PIISPGPAIRNAIRMATGVAINALPITPKTLYREFVQAGLIRE
NT seq 2292 nt   +upstreamnt  +downstreamnt
atgtctttaggatcgccgctgcggcgggttgatgccgaagccaaggtcaccggacaggcg
cgttataccgatgatatgatgatgcccggcatgctccatgcctgctacgtgcgcagccgt
atcgcccacggtaacgtcaccgccatcgatacccgggaagcggagtccatgcccggcgta
gaagccgtcttcacctttcacgatgtcccctcagcccccttccctaccgccggccacgcc
tggtcgctggagccgggcaaacgggatatcgccgatcgccatctgctgaccggccacgtg
cgccactttggcgacggcgtcgccatcgtcgtcgcccgcgatctgctcagcgccgagcgc
gccgcggcgcgggtacaggtcagctatgatgcgttgccggtgatcacccggccacaggcg
gccctggccgacggagcaccggccattcaccccggcggcaatttgctgcgccacagcgag
atcgacgccggagagccagaagcccgcatcgccgccgccgatctgcagctggagggtcac
tacgagacgccggtggtgcagcactgccacatggagggcgtgacctgctatgcctatatg
gagcagcccgatcacatcgtcattgtctccagcacccaaattccccagattgtccggcgc
accgtcgcccaggccctcggtctcccctggtcgcacgtccgggtgatcaagccctacgtc
ggcggcggattcggcaataagcaggatgtgctggaagagcccatggccgcctttttaacc
cagcgcctcggcggtaaaccggtcaaggtcagcctgagccgggaggagtgcttcgtcgcc
acccgcacccgccacgccttcagcatcgatgcccggctgggtatgcgccgggatggtctg
ctggaggggtaccgtctgacggtgctgtccaataccggcgcctatgcctctcacggccac
tcaattgccgccgccggtgccaataaaatcagctatctctatccccgcagcgcctttggc
tactgcgctgatacggtatataccaacctgcccgccgccggtgcgatgcgcggctacggc
gcgccacaggtcgacttcgccctggagtgcctgatggacgacgccgcggcccgcctcgat
ctcgatcccctcgaggttcgtctgcgcaacgttgcgcgtcagggcgaccgtaacccggtt
aacggaaagagcatctacagcgccgggctcacagagtgcctggaaaaaggccgccgtctg
tttgagtgggatcggcgccgcgccgaatgtatggcccagtcggccgatgcgccggtacgg
cgcggcgtcggtgtcgcctgtttcagctatggttccaatacctatccggtcggggtggag
atcgccggcgcccgtctgctgctcaatcaggacgggacggtaaacctgcagattggcgct
accgaaattggccagggatccgataccgtcttcgcccagatggcatcggaaacgctgggg
atcccctttaaacagatccgggtgatctcaactcaggataccgatatcaccgccttcgat
cccggcgcctttgcctcacggcaaagctatgtcgccgccccggcgatccgccgcgcggcg
gagatcatgcgtcagaaaatcctggcgcacgcggcgctgataagtcaccagccggagtgg
ggattgaccctgtgcgacggtaacgtagtgatggcgatgcagccggatcaggtgctaatg
agcgtcgccgacgtcgccatgcaggcctactaccaccaggagatcggcgcacagatcctg
gccgaggtctcccataaaacaaccaccaatcccccggccttcggctgcacctttgtcgat
ctcagcatcgacatcgcgctgtgccaggtcaccattaaccgcatcctgaatctgcatgac
tccgggcggatcctcaacccgcagctggcggagggacaggttcacggcggtatggggatg
gggatcggctgggcgctgttcgaagagatgatcatcgatgagaagagcggcgtggtacgc
aacccgaatctgctcgactacaaattccccacctgtgtcgatctgccggatctggagtgc
gccttcgtcgaaacggtggagccgcagtcggcctatggccacaaggcgctgggggagccg
ccgatcatttcgcctggaccggcgatccgcaacgccattcgcatggcaacgggggtcgcg
atcaatgcgctgccgatcacccccaaaacgctgtatcgcgaatttgtgcaggccggactg
atcagggagtaa

DBGET integrated database retrieval system