KEGG   Edwardsiella sp. EA181011: QY76_17335
Entry
QY76_17335        CDS       T03991                                 

Definition
(GenBank) xanthine dehydrogenase
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
edw  Edwardsiella sp. EA181011
Pathway
edw00230  Purine metabolism
edw01100  Metabolic pathways
edw01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:edw00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    QY76_17335
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: AKM48832
Position
3925328..3925813
AA seq 161 aa
MNVKEWVEITCQINGKTYQFCVSPAMSLLEMLREHGLTSVKQGCCVGECGACSVLIDGVA
TDSCLYLALWADGKQIVTADGLGRADSLSPIQQAYVDAGAVQCGFCTPGLVVATHALLAK
PRSRPLTHQEIRRGLSGNLCRCTGYQAIVRAVDLCQREEDQ
NT seq 486 nt   +upstreamnt  +downstreamnt
atgaatgtcaaagaatgggttgaaatcacctgccagatcaatgggaaaacctatcagttt
tgcgtgtcgccggcgatgtcgctgctggaaatgctgcgcgagcacgggctaaccagcgtg
aagcagggctgctgtgtcggtgagtgcggcgcctgcagcgtattgatcgatggcgtggca
accgacagctgcctgtacctggcgctgtgggccgacggtaagcagatcgtcacggccgat
gggctgggccgagccgacagcctttcgccgatccagcaggcctatgtcgacgccggcgca
gtgcagtgtggtttctgtaccccgggactggtggtcgcgacccatgccctgctggcgaaa
ccgcgcagtcgcccgctgacgcaccaggagatccgccgcggcctctccggcaacctgtgc
cgttgcaccggctatcaggccatcgtacgcgccgtcgatctctgccagcgcgaggaagat
cagtag

DBGET integrated database retrieval system