KEGG   Enterobacter ludwigii EcWSU1: EcWSU1_00307Help
Entry
EcWSU1_00307      CDS       T01652                                 

Gene name
alsK
Definition
(GenBank) D-allose kinase
  KO
K00881  allose kinase [EC:2.7.1.55]
Organism
eec  Enterobacter ludwigii EcWSU1
Pathway
eec00051  Fructose and mannose metabolism
eec01100  Metabolic pathways
eec01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    EcWSU1_00307 (alsK)
Enzymes [BR:eec01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.55  allose kinase
     EcWSU1_00307 (alsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: AEW71747
UniProt: G8LIC3
Position
complement(327003..327947)
Genome map
AA seq 314 aa AA seqDB search
MQKQPDVVAGVDMGATHIRFCLLTAEGAVLHCEKHRTADIIRSGVMCGVAEMIVARLRHY
QVRCRGLVMGFPALVGKDKRTIISTPNLPLQATDRRDLAGKLADALGCPVEFYRDVNLQL
SFDVMQHNLQQQQVLAAYLGTGMGFAIWLNGAPWTGAHGVAGELGHIPQGDMSRHCGCGN
TGCLETVCSGIALKQWYEQQPRDYAIGEIFTSACHDPFVIQLLNHAARAIATSVNLFDPD
AVILGGGVMDMVDFPRDALIARIKQHLRRPLPYEAVRFITASSSSFNGAQGAATLALSQF
LSSPCATPAPAVRG
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaacagcctgatgtcgttgccggagtggatatgggcgctacccatatccgtttt
tgcctgcttacagccgagggggccgtgctgcactgtgaaaaacaccgtacagcagacatt
atccgttcaggcgtcatgtgcggcgtcgcagaaatgatcgttgcaaggcttcgccactat
caggttcgctgtcggggtctggtgatgggttttcctgcgctggtcggcaaagacaaacgc
accattatctcgacaccaaacctgccattacaggcaacagaccgacgggacctggcgggc
aaactggcggacgcgctgggatgcccggtcgaattctaccgtgacgttaacctccagctc
tcttttgatgttatgcagcacaacttgcagcaacagcaggttctggcagcctatctcggt
accggcatggggttcgccatctggctgaacggcgcgccctggacaggtgcacacggggtc
gcgggcgagcttggacatattccgcagggcgatatgtcacgccattgcggttgtggtaac
acaggatgtctggaaaccgtctgttccggtattgccctgaaacagtggtatgaacaacag
ccccgtgattacgcgattggcgagatttttacctcagcgtgtcatgacccctttgtcata
cagctcttaaatcatgcagcccgagccattgccaccagcgtaaatctcttcgacccggat
gcggtgatcctcggcggcggcgtgatggatatggtcgattttccacgcgacgcgctgatt
gccagaattaaacagcatctgcgccgtccgctgccgtatgaggcagtccgtttcattaca
gcatcatcgtcatcctttaacggtgctcagggggcggcgaccctggctctcagccagttc
ctgtcatcaccttgcgcaacgcctgcgccagctgtacgcgggtaa

DBGET integrated database retrieval system