KEGG   Enterobacter ludwigii EcWSU1: EcWSU1_00363Help
Entry
EcWSU1_00363      CDS       T01652                                 

Gene name
psd
Definition
(GenBank) Phosphatidylserine decarboxylase proenzyme
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
eec  Enterobacter ludwigii EcWSU1
Pathway
eec00564  Glycerophospholipid metabolism
eec01100  Metabolic pathways
eec01110  Biosynthesis of secondary metabolites
Module
eec_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:eec00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    EcWSU1_00363 (psd)
Enzymes [BR:eec01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     EcWSU1_00363 (psd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase Peptidase_C48
Motif
Other DBs
NCBI-ProteinID: AEW71803
UniProt: G8LIH9
Position
complement(386129..387142)
Genome map
AA seq 337 aa AA seqDB search
MRPDQERQNNGLEATLLNSFKLSLQYILPKLWLTRLAGWGASKRAGWLTKLVIDLFVKYY
KVDMKEAQKPDTASYRTFNEFFVRPLRDDVRPLNTDPNVLVMPADGVISQLGHIEDDKIL
QAKGHNYSLEALLAGNYLMADLFRNGTFATTYLSPRDYHRVHMPCNGILREMIYVPGDLF
SVNHLTAQNVPNLFARNERVICLFDTEFGPMAQILVGATIVGSIETVWAGTITPPREGVI
KRWTWPAGEEEGSVALLKGQEMGRFKLGSTVINLFAPGKVKLAEQLESLSVTKLGQPLAV
STETFVTPVAEPAPLSQEEIDAEHDASPLVDDKKDEG
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
ttgcggccggatcaggaacgacaaaacaatggcctggaggctaccttgttaaactcattt
aaactttcgcttcaatacattctgccgaaactgtggctcactcgcctggcgggctggggc
gcgagcaaacgagcgggctggctgaccaaactggtcatcgaccttttcgtaaaatattac
aaggttgacatgaaagaggcgcagaagccggataccgccagctaccgcaccttcaacgag
tttttcgtccgcccattgcgcgacgacgtgcgcccgctgaatacggaccctaacgtgttg
gtgatgcctgcagatggcgtgattagccaactgggtcacatcgaagacgacaaaatcctg
caggcgaaaggccataactacagcctggaagcattgctggcaggtaactacctgatggcg
gatctgttccgtaacgggaccttcgcgaccacctatctctcaccgcgcgactatcaccgc
gtgcacatgccgtgcaacggcatcctgcgtgaaatgatctacgttccgggcgatctgttc
tccgtgaaccacctcacggcgcagaatgtacctaacctgttcgcccgtaacgaacgcgtc
atctgcctgtttgatactgaattcggccctatggcgcagattctggtgggcgcgaccatt
gtcggcagcattgaaaccgtctgggctggcaccatcaccccaccacgtgaaggcgtgatc
aagcgctggacctggcctgccggtgaagaagaaggctctgtcgccctgctgaaaggtcag
gagatgggtcgcttcaagctgggctcaaccgttatcaacctgtttgcaccgggtaaagtt
aagctggccgaacagcttgaaagcctgtcggtcaccaaactgggtcagccgctggccgtc
tctaccgaaaccttcgtaacgccagtggcagaacctgcaccgttgtcccaagaagagatc
gacgccgagcacgacgccagcccgctggttgacgacaaaaaagacgaaggctaa

DBGET integrated database retrieval system