KEGG   Enterobacter cloacae EcWSU1: EcWSU1_00502Help
Entry
EcWSU1_00502      CDS       T01652                                 

Gene name
cscA
Definition
(GenBank) Sucrose-6-phosphate hydrolase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
eec  Enterobacter cloacae EcWSU1
Pathway
eec00052  Galactose metabolism
eec00500  Starch and sucrose metabolism
eec01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    EcWSU1_00502 (cscA)
   00500 Starch and sucrose metabolism
    EcWSU1_00502 (cscA)
Enzymes [BR:eec01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     EcWSU1_00502 (cscA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43 DUF4975
Motif
Other DBs
NCBI-ProteinID: AEW71942
UniProt: G8LK96
Position
535174..536607
Genome map
AA seq 477 aa AA seqDB search
MTSLLEQAEQVLEKAQSGINPRWYPRYHLAPRAGWMNDPNGLVWFDGWYHAFYQHHPYSP
KWGPMHWGHARSKDLVHWEHLPVALAPEGPADKDGCFSGSAVVDGDTLALIYTGHKFHGP
SDTDDNLYQVQCLATSRDGIHFELHGRVIDTPPGLHHFRDPKVWREGEFWYMVVGSRVEN
TGQVRLYRSTDLREWHDEGIFAEADEGKGFMWECPDFFTLGEKRVLMFSPQGMAAEGYHY
RNLFQSGYLLGDWQPGQPFTHSGQFTELDHGHDFYAPQSFVTPDGRRIVIGWLDMWESPM
PEQQDGWAGMLSLPRELSLVDGRVRMKPAAEVTALRGSYYPTPVRCLNNQNVLVAADADA
VEVQLAWDLSASTAEQFGIALGDGLRIYVDDQAGRLVVERRYPQYSLEGTRSIPLPADSV
LSLRIFIDRSSVEVFVNDGDACLSSRIYPQPGKRDISLFANQGKASLYDAGYWSLDK
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgacatccttattagaacaggctgaacaggtgcttgaaaaagcacaatccgggattaat
ccgcgctggtatccgcgctatcacctcgcccctcgcgcaggctggatgaatgatcctaat
ggcctggtatggtttgacggctggtatcacgccttttatcaacatcatccctattccccg
aaatggggtccgatgcactgggggcatgcccgaagcaaagatctggtgcattgggaacat
ctgcccgtcgcgctagcgccggaaggcccggcggacaaagacggctgtttctccggctcc
gccgtggtggacggcgatacgctggcgctcatctacaccggacataaatttcacggcccg
tcggacacagacgacaacctctaccaggtgcagtgtctggcgaccagtcgtgacggcatt
cattttgaactgcacggcagggtgattgatacaccgcccggactgcatcactttcgcgat
ccgaaggtgtggcgcgaaggtgagttctggtacatggttgtcggctcccgcgtggaaaat
accggccaggtgcgcctgtaccgttccaccgatctccgcgaatggcatgacgaaggtatt
ttcgccgaggctgatgaaggcaagggctttatgtgggaatgcccggatttcttcaccctg
ggagagaagcgtgtcctgatgttctcgccgcagggcatggcggcggaagggtatcattat
cgcaacctgttccagagtggctatttacttggggattggcagccaggtcaaccgttcacc
cacagcggacaatttactgagctggaccacggccacgacttttatgccccgcagagtttc
gtgaccccggatggccgacgcattgtcatcgggtggctcgatatgtgggaatcaccgatg
cccgaacagcaggatggctgggccggaatgctctcgcttccgcgcgaattaagccttgtt
gatggccgtgtgagaatgaaaccggctgccgaagtgaccgcgctgcgtggcagctattat
cccacgcccgtccgctgtctgaacaatcagaacgtccttgtcgcggcagatgccgacgcg
gtcgaagttcagctggcatgggatttgagcgcatcgacggctgaacagtttggtatcgcg
ttgggcgacgggctgagaatttacgtcgacgatcaggccgggcgtctggtggtggagcgt
cgctatccgcaatattcgctggaaggcacgcgcagtattccgctaccagcggacagcgtt
ctgtcactgcgaatttttattgaccgctcatcggtggaagtttttgttaacgatggtgac
gcttgcttaagcagtcgtatttatccgcagccgggcaagcgcgatatttcattgtttgca
aatcaggggaaggcctcattatacgatgcgggatactggtctttagataaataa

DBGET integrated database retrieval system