KEGG   Enterobacter ludwigii EcWSU1: EcWSU1_00665Help
Entry
EcWSU1_00665      CDS       T01652                                 

Gene name
apaG
Definition
(GenBank) ApaG
  KO
K06195  ApaG protein
Organism
eec  Enterobacter ludwigii EcWSU1
Brite
KEGG Orthology (KO) [BR:eec00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    EcWSU1_00665 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: AEW72105
UniProt: G8LM21
Position
complement(693295..693672)
Genome map
AA seq 125 aa AA seqDB search
MIDSPRVCVHVQSVYVESQSSPDEERFVFAYTVTIRNLGRMPVQLLGRYWLITNGNGREI
EVQGEGVVGEQPHIDPGEEYQYTSGAVIETPLGTMQGHYEMVDVDGNVFRVAIPVFRLAV
TTLIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgattgattcgccccgcgtatgtgtccatgtacaaagcgtttatgttgaatcccagtcc
tcaccggatgaagaacgttttgtcttcgcttacaccgtgaccattcgcaatctggggcgg
atgcctgtgcaactgcttgggcgctactggcttatcaccaacggcaacggccgcgaaatc
gaagttcagggtgaaggtgtggttggtgaacagccccacatcgaccctggcgaagagtat
caatataccagcggtgccgtgatcgaaacgccgctgggtaccatgcagggccattacgaa
atggtcgacgtcgatggcaatgtgttccgcgttgctattcctgtgttccgtctcgccgtt
acaacactcattcattaa

DBGET integrated database retrieval system