KEGG   Enterobacter ludwigii EcWSU1: EcWSU1_02666
Entry
EcWSU1_02666      CDS       T01652                                 

Gene name
rhsB
Definition
(GenBank) RhsB
Organism
eec  Enterobacter ludwigii EcWSU1
SSDB
Motif
Pfam: RHS_repeat RHS PAAR_motif DUF4150
Other DBs
NCBI-ProteinID: AEW74098
UniProt: G8LFB4
Position
complement(2748218..2752606)
AA seq 1462 aa
MSDNNAARQGDEIIHSSIFADITSIVAEGAAYAVIGAAVGAAATVAAPLLGAGAAAAGVA
AIGSSCLLSGIIGGVLANVAGITDDISNAAEGLGNALFPPSPAGKITTGSDNVLTNAIPA
ARAAGTLTPADTPSPEPQSPGSFADYAGMLLSAAGQFGSEMWQPSVASAAAGTSPLEEDK
VACEKHSGPQYLAEGSKSVFINGQPAVRAKDRTTCEGTVSDDVSPNVIIGGETLTVRDIK
SGKTPGLALGMIALSLLRGRPGKILKNMPCALAAAGGGMLADMAVNAVFGSSHPVHAATG
VKVLNDDDELDFSLPGRFPLRWQRSYNSLTTREGLFGLGWATTFDSYLTLEENNAIWFDE
TGRELSFELPPVDRAFYSISEGIIIRRNESGDVAIADDDGAVWRLYKPTRANPTLLRLAS
LSDEYGNALLTEWDEHGRLVNLHDEPRAIDVTLRYEDERFPQRATSASHFDGNRTWPLMQ
WGYDARGQLASVTDASGVVTREYRYNDHGLMVWHRLPGGLESEYRWQKFDHWRVVENRTS
TGDGCRFNYDLAAGLTTVEHYDGQTRKHYWNAQNLIVRYVDERGENWCYEWDENELLTRR
IDPLGNAVTFVYDEMGNRVQEIDADGNTRTTTWLEHRALPSAIIEADGSATRFWYDEHHG
LKRVVDPMGQTTLLRRDEFGQVVEEVDAAGNSRYQEYNEAGQVIRATDCSGRITRYTYHP
LGWLTTEIGADGEETRYRYDAAGRPVQLDRPEGWTESLAWNERGLPVTHAGADGKESEFK
YDEAGRLTATRNTQGEEVRRRWDSRGRLIALENENGEAYQFRWGADSLLLEEVGLDGVAS
QYRYDACGRTIARTFAAGHPEAITHAFAWSASGQLVARTTPEGQTRYHYTPSGLLSRIGL
HPALSVDAWSAEAEQELAFEYDALGRVTREVGEHGELAWEYDALGNRTSVTLPDGRELKQ
FYYGSGHLLSIALDKLSVSDFTRDELHRETSRTQGLLTTRSEYDRLGRLHRRDVFTGNAQ
RPSPRRWSHRWDYDYRNNLVREERDDNPFSWYRWQYDSAGRLLVQDGTLPGQEQWRWDAA
GNPLEGSAEKVTHNRLTQLNGIRWRYDIHGRTVEKDNGQTRWHYRYDGEHRLTEVISQPR
DRNKPQTQVSFRYDPLGRRISKTRRQMLGGQPTGKPVSTRFVWEGFRLLQEVHGDVPLTY
VYSDQDSYDPLARIDGVDAPEIFWFHCQPNGTPERMTDSEGQVRWEGVNSTWGKLLRESE
TQVSGYSQNLRMQGQYLDRETGLHYNLFRYYDPDCGRFTQQDPIGLAGGINLYQYGANSL
TRIDPLGLKQEEVIRYMSKDEAIASASERDGKGGLVPNNRGEKAIWVNHDSRPGFNPGNE
KYRAVMTVNDSGVELLNQHSDISKVDYKETGLKDGVLSKRNEPGARGIGKNILSRFNDKI
TSFQIEKKDAKGNWKKCGKRIT
NT seq 4389 nt   +upstreamnt  +downstreamnt
atgagcgataacaacgcggcccgtcagggcgacgagatcattcactccagcatttttgcg
gatatcaccagtattgtggcggaaggtgcggcctatgccgttatcggcgctgccgtgggc
gcggcggcaaccgttgctgctccgctgctgggggcgggtgccgccgctgcgggcgtggcg
gctattggatccagctgtctgttaagtgggatcattggcggcgtactggcaaacgtggca
ggtataactgacgatatcagcaacgccgccgaaggcttaggcaacgcgctgttcccaccg
tcgccagcgggcaaaatcaccaccgggtctgataacgttctgacgaacgcgattcccgct
gcacgagcggccgggacgctgacgcccgccgacacaccgtcacctgaaccacagtctccg
ggcagctttgccgattacgccggcatgctgctttccgccgctggacagtttggcagcgag
atgtggcagccgagcgtggcttctgccgccgcgggaacctcgccgctggaagaagacaag
gtggcgtgcgaaaagcactccgggccgcagtatctggcggaaggctctaaaagcgtcttc
attaacgggcagcccgcggtacgtgcaaaagatcgcaccacctgcgaaggcaccgtttcc
gacgatgtctccccgaatgtgatcatcggcggggaaacgctcacggtccgcgatatcaaa
agcggtaaaacgccgggtctggcgctggggatgattgcgctctccctgctgcgcgggcgt
ccgggtaaaatcctgaaaaatatgccctgtgcgctggcggcagccggcggtggtatgctg
gccgatatggccgttaatgctgtgtttggctcctcgcacccggtacatgctgcaaccggc
gtgaaggtgctgaatgatgacgatgaactcgatttctcgctgccggggcgcttcccgctg
cgctggcagcgcagctacaacagcctgaccacccgtgaagggctgtttggtctgggttgg
gcgacaacctttgacagctatctgacgctcgaagagaacaacgcgatctggttcgacgaa
accggccgtgagctgagctttgagctgccgcccgtcgatcgcgcgttttacagcatcagc
gaaggcatcatcatccgccgcaatgagagcggcgacgtggcgattgccgacgatgacggc
gcggtatggcgtctgtataaaccaacccgggcgaatcccaccctcctgcgtctggcctcc
ctcagcgatgaatatggcaacgcgctgctgacggagtgggatgaacacggcaggctggtc
aatcttcacgatgagccacgggcgattgatgtcaccctgcgctatgaagatgagcgtttc
ccacagcgcgccacctctgccagccattttgacggcaaccgtacctggccgctgatgcag
tggggttacgatgcgcgcggccagctggcgagcgtgacggatgcctctggcgtagtgacg
cgcgaataccgctataacgaccacggcctgatggtctggcaccgcctgccgggcgggctg
gagagcgaataccgctggcaaaaattcgaccactggcgtgtggtggaaaaccgcaccagc
accggcgacggctgccgttttaactatgatttagccgccgggctgacgaccgtcgagcac
tatgatggccagacgcgtaagcactactggaacgcgcaaaatctgattgtccgctacgtt
gacgagcgcggtgaaaactggtgctacgagtgggatgaaaacgaacttctgacccgtcgc
atcgatccgctcggtaacgccgtcaccttcgtctacgacgaaatgggcaaccgggtgcag
gaaatcgacgccgacggcaatacccgcaccaccacctggctggagcaccgcgcgctgccg
tcagccatcattgaagccgacggcagtgcgacccgtttctggtacgacgaacatcacggg
ctgaagcgtgtggtagacccgatggggcagacaacactgctgcgccgggacgagtttggt
caggtcgttgaagaagttgatgccgcgggaaacagtcgctaccaggagtacaacgaggcc
gggcaggtcattcgtgccacagactgttcaggacgaataacccgctatacctatcatccg
ctgggctggttaacgactgagatcggcgctgacggcgaagagacgcgctatcgctacgat
gccgcagggcgtccggtgcaactcgatcgaccggaaggctggacagagtcgctcgcatgg
aacgaacgcggcctgccggtgacgcatgcgggcgctgatggcaaagaaagtgagtttaaa
tacgacgaggcaggacgattaaccgctacgcgtaatactcagggtgaagaggtccgccgc
cgctgggacagccgcgggcgactgattgccctggaaaacgaaaacggcgaagcgtaccag
ttccgctggggtgcggactcgctgctgctggaagaggtggggctcgatggcgtggcctca
cagtatcgctatgacgcctgcgggcgtacgatagcgcgcacgtttgccgccggtcatccg
gaagccatcacccatgccttcgcctggagcgcgagtggccagctggttgcccgcaccacg
ccggaagggcagacccgttatcactacacaccgtcaggtttgctgagtcgtattggactt
catccggcactttccgttgacgcctggagtgcagaggcagaacaggaacttgcctttgag
tatgacgccctggggcgtgtcacgcgtgaagtgggcgagcacggtgagctggcatgggag
tatgatgctctcggcaaccgcacctccgtcacgctgcccgatggccgcgagctgaaacag
ttctactacggcagcgggcatctgctcagcattgccctcgataagctgtcggtctctgat
tttacccgtgacgaactccaccgtgagaccagccgcacccaggggctgctgaccacccgc
agcgagtacgaccgtcttggtcgactgcatcgccgggatgtattcactggcaatgcccaa
cgtccgtcgccgcgccgctggtcccaccgctgggattatgactaccgcaataacctggtg
cgggaagagcgggacgataacccgttcagctggtaccgctggcagtacgacagcgccggg
cgtttgcttgttcaggacggaacgctgcccggccaggagcagtggcgctgggatgctgcc
ggtaacccgctggaagggtctgctgagaaggtcacgcacaaccgcctgacgcaactgaac
ggcattcgctggcgctatgacatccacggccgcaccgtggagaaagataacggccagacc
cgctggcactaccgctacgacggtgagcaccgtctgacggaagtcatcagccagccgcgg
gaccgtaacaaaccgcagacgcaggtcagcttccgctacgatccgcttgggcgacgcatc
agcaaaacgcgacgccagatgctgggcggacagccaaccggcaagccggtcagcacccgg
tttgtctgggaaggtttccgcctgctgcaggaagtgcacggggacgtgccgctaacctac
gtctacagcgatcaggacagctacgatccgctggcgcgtatcgacggcgttgatgccccg
gagatcttctggttccactgccagcccaacggtacgccggagcggatgacggatagcgaa
gggcaggtgcgctgggaaggggtgaacagcacctggggcaagctgctacgggaaagcgag
acgcaggtatcaggatattctcagaacctgcgcatgcaggggcaatacctggaccgtgag
acagggctgcactacaatctgttccggtattacgacccggactgcggtaggtttacgcag
caggacccgatagggctggcgggggggataaacctttaccagtatggtgcaaatagttta
acccgaatagaccctctgggattaaaacaagaggaagttatacgctatatgagtaaagat
gaagcgattgcatcagcttctgaacgtgatggtaaaggcggattggttcctaataatcgt
ggtgaaaaagccatatgggttaatcatgatagccgaccagggtttaaccctggaaatgaa
aagtatcgtgccgttatgaccgtaaatgactctggggttgagcttcttaatcaacatagt
gatatatcaaaagttgattacaaagaaaccgggctgaaagatggagttctatcaaagaga
aatgaacctggagcaaggggcatcggtaaaaatatcctttctcgttttaatgataaaatc
acttcattccagattgaaaagaaagatgctaaaggtaattggaagaaatgtggtaagagg
attacttaa

DBGET integrated database retrieval system