KEGG   Enterobacter ludwigii EcWSU1: EcWSU1_02670Help
Entry
EcWSU1_02670      CDS       T01652                                 

Definition
(GenBank) hypothetical protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
eec  Enterobacter ludwigii EcWSU1
Pathway
eec03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:eec00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    EcWSU1_02670
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eec02044]
    EcWSU1_02670
Secretion system [BR:eec02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EcWSU1_02670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_GPD DUF2345 Nsp3_PL2pro Gp5_C Phage_base_V
Motif
Other DBs
NCBI-ProteinID: AEW74102
UniProt: G8LFB8
Position
complement(2755324..2757246)
Genome map
AA seq 640 aa AA seqDB search
MLNRITVQLPVEGLLFWKLTGREAMSESFALTLTLLGTDARIDRSKLLGQPVTVTIPTQS
LLTPRYINGKITRVAVSAVELTGTRYAVYQLTVEPDLWPMKRDRNLRIFQGQTVPQIVKT
LLGEHQVNVEDKLTGSYRVWDYCVQYQESSLDFISRLMELEGVAYHFSHEADKHTLVLTD
AATQHQPFSGYEVIPYHQTPSGGSTDEEGISQWALEDSVTPGIYSLDDYDFRKPNAWLFQ
AQQNPASPKPGSIDVYDWPGRFVETGHAEFYARIRQERWQVEHQQIQATATAAGIAPGHT
FTLTSAPFFSDNGDYLVTAAGYHFEENRYASGEGETLHRTDFAVIPASVSYRPAQSTAWP
RTYGPQTAKVVGPNGESIWTDKYGRVKVKFHWDRLAKGDDTSSCWVRVSSAWAGQGYGGV
QIPRVGDEVVVDFINGDPDRPIITGRVYNEASMPPWALPAAATQMGFMSRTKDGSVDNAN
ALRFEDKAGAEQVWIQAERNMDTSIKNDETHSVGGERSHYVKKNELHRVEANQIQAVKGG
TEILTGKGKLDAAVEQYVIASGTKLRLVSGESAIELNANGKINLIGKEFNFFVEGDGHIT
TGGKLHLNTSGTQPGTTAPGSGHKGDIDAAVQEKFTTKGE
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaccgaattaccgttcagctcccggtggaggggcttctgttctggaaactcaca
ggtcgcgaggcgatgtccgagtcgttcgccctgacgctgaccctgcttggcacggatgcg
cgcattgaccgcagcaaactgctgggtcagccggtcacggtgaccatcccgacgcagagc
ctgctgacgccccgctatatcaatggaaaaatcacccgcgtggcggtgagtgccgtcgag
ctgacgggcacccgctatgcggtgtaccagctgacggtggagccggacctgtggccgatg
aagcgcgaccgtaacctgcgtatcttccagggccagacggtaccgcagattgtgaaaacc
ctgctgggtgaacatcaggttaacgtggaagataagctcaccgggagctaccgggtgtgg
gactactgcgtgcagtatcaggagtcgagcctggacttcatcagccgtctgatggagctg
gagggggttgcgtatcacttcagccacgaggcggacaagcacacgctggtgctcaccgac
gccgccacgcagcaccagccgttcagcggctatgaggtcattccttaccaccagacgccg
tcaggcggcagtacggacgaagagggcatcagccagtgggcgctggaggacagcgtgacg
ccggggatttacagcctcgatgactacgacttccgcaagccgaacgcgtggctgttccag
gcgcagcagaacccggcgtcaccgaaaccgggcagtatcgacgtgtacgactggccggga
cggtttgttgagaccgggcatgcggagttctacgcccgtatccgtcaggagcgctggcag
gtggagcaccagcagattcaggcgacggccacggccgcgggtattgcaccgggacacacc
ttcaccctgaccagcgccccgttcttcagtgataacggtgactatctggtcacggcggcg
ggttaccatttcgaggagaaccgctacgcgagcggcgagggtgaaacccttcaccgcact
gatttcgcggttatcccggcgtcggtgtcataccgtccggcgcagagcacggcgtggccg
cgcacctacggcccgcagacggcaaaggttgtggggccaaatggggagagtatctggacg
gacaaatatggccgcgtgaaggtgaaattccactgggaccgtctggcgaagggggatgac
accagctcctgctgggtgcgcgtgtcgagcgcctgggcgggtcaggggtatggcggagtg
caaattccgcgggtcggcgatgaggtggtggtggactttatcaacggtgacccggaccgt
ccgattatcaccgggcgggtgtataacgaagcaagcatgccgccgtgggcgctgccggcg
gcggccacgcagatgggttttatgagccgcacgaaggatggctccgtggataatgccaat
gccctgcgctttgaggacaaggcgggcgcagagcaggtgtggatccaggctgagcgcaac
atggacaccagcattaagaacgatgaaacgcacagcgtcggtggcgagcgcagccattat
gtgaagaaaaatgaactgcatcgggtggaagcgaatcagatccaggcggtgaaaggcgga
acagagatcctgacgggcaaaggcaagctggatgcggcggtggagcaatatgtcattgct
tccggtacgaagctacggctggtctctggtgaaagcgcaattgagctgaacgctaacggc
aagattaacctcatcggcaaagagtttaatttcttcgttgaaggggatggtcatatcacc
accggcggtaagctgcacctgaatacgtctggcacacaaccgggcaccacggcgccgggt
tccgggcataaaggggatattgatgcggcagttcaggagaaatttacgactaaaggtgag
taa

DBGET integrated database retrieval system