KEGG   Enterobacter ludwigii EcWSU1: EcWSU1_02683
Entry
EcWSU1_02683      CDS       T01652                                 

Definition
(GenBank) hypothetical protein
  KO
K11897  type VI secretion system protein ImpF
Organism
eec  Enterobacter ludwigii EcWSU1
Brite
KEGG Orthology (KO) [BR:eec00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eec02044]
    EcWSU1_02683
Secretion system [BR:eec02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EcWSU1_02683
SSDB
Motif
Pfam: GPW_gp25 DUF2113
Other DBs
NCBI-ProteinID: AEW74115
UniProt: G8LFD0
Position
complement(2773959..2774540)
AA seq 193 aa
MLRMEPMSNPAGEGDLLRSGWQARSKQEKVGARDKMQPSLLDRLTDNDPEKKRESANSNL
ITHAALRRNVLRDLQWLFNTINHDASGDLSALPHVNRSVVNFGVAPLAGKRMSDIEWHDI
QRKLTEAIINFEPRILPQGLQVRCVSDTSSLDLHNVLSIEIKGRLWCVPYPLEFLFRTDV
DLENGHFELKDAG
NT seq 582 nt   +upstreamnt  +downstreamnt
ttgctgcggatggagcccatgagtaatcccgctggcgaaggcgatctgctgcgcagcggc
tggcaagcccgcagcaagcaggagaaggtgggggcgcgcgataaaatgcagccctcgctg
ctggatcgcctcaccgataacgatccggaaaaaaaacgcgagtccgccaacagtaatctg
attacccacgccgccctgcgccgcaacgtgctgcgggatctgcagtggttgtttaacacc
atcaaccatgacgcatccggcgacctgagcgcgttgccgcatgtgaaccgctcggtggtt
aattttggcgtcgcgccgctggccgggaaaagaatgtcagacattgaatggcacgacatt
cagcgcaagcttaccgaggccatcattaactttgaaccgcgtattttgccgcagggactg
caggtccgctgcgtgtcagacacctcgtcactggatctgcacaacgtgttgtccattgag
ataaaagggcgtctgtggtgtgtgccgtacccgctggagtttctgtttcgcaccgatgtc
gatctggaaaacggccattttgaactgaaagatgcggggtga

DBGET integrated database retrieval system