KEGG   Enterobacter ludwigii EcWSU1: EcWSU1_02691
Entry
EcWSU1_02691      CDS       T01652                                 

Definition
(GenBank) hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
eec  Enterobacter ludwigii EcWSU1
Brite
KEGG Orthology (KO) [BR:eec00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eec02044]
    EcWSU1_02691
Secretion system [BR:eec02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EcWSU1_02691
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: AEW74123
UniProt: G8LFD9
Position
complement(2783655..2784194)
AA seq 179 aa
MMENIMAMSNSGQKFIARNRAPRVQIEYDVEIYGAERKIQLPFVMGVMADLVGKPVENLP
AVDERKFLEIDIDNFDERMKALKPRVAFQVDNTLTGEGKLNVDLTFDSMDDFLPDAVARK
VEPLNKLLEARTQLSNLLTYMDGKNGAEELIAKILQDPTLLKSLSQLPKNDESAKGSEE
NT seq 540 nt   +upstreamnt  +downstreamnt
ttgatggagaacatcatggcaatgagtaacagtgggcagaaattcatcgcacgtaaccgt
gccccccgcgtgcagatcgagtacgacgtagagatctacggtgcagaacgtaaaattcag
ctgccgtttgtgatgggcgtcatggccgatctggtcggcaaaccggtggaaaacctgccg
gcagtcgatgagcgtaaattcctcgaaatcgacattgataactttgacgagcgcatgaaa
gcgctgaaacctcgcgtggcgttccaggtggataacacgctgaccggcgaaggtaagctc
aacgttgatctcaccttcgacagcatggacgacttcctgccggacgcggtagcccgcaag
gttgaaccgttgaacaagctgctggaagcacgtactcaactctccaacctgctgacctat
atggatggcaaaaacggcgcggaagagctgatcgctaaaattctgcaggatccgacgctg
ctcaaatctctgagccagttgccgaaaaatgacgaaagcgcgaaaggtagcgaggaataa

DBGET integrated database retrieval system