KEGG   Enterobacter ludwigii EcWSU1: EcWSU1_03187Help
Entry
EcWSU1_03187      CDS       T01652                                 

Gene name
hisQ
Definition
(GenBank) Histidine transport system permease protein hisQ
  KO
K10016  histidine transport system permease protein
Organism
eec  Enterobacter ludwigii EcWSU1
Pathway
eec02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:eec00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    EcWSU1_03187 (hisQ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eec02000]
    EcWSU1_03187 (hisQ)
Transporters [BR:eec02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    EcWSU1_03187 (hisQ)
   Histidine transporter
    EcWSU1_03187 (hisQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 SARS_lipid_bind
Motif
Other DBs
NCBI-ProteinID: AEW74615
UniProt: G8LLI2
Position
complement(3318301..3319041)
Genome map
AA seq 246 aa AA seqDB search
MGGEKTRFHHSRYDRARGMLYGFSGVILQGALVTLELALSSVVLAVLIGLAGAGAKLSAN
KPLALIFEGYTTLIRGVPDLVLMLLIFYGLQIALNSVTDAMGMGQIDIDPMVAGIITLGF
IYGAYFTETFRGAYMAVPKGHIEAATAFGFTSSQTFRRIMFPAMMRYALPGIGNNWQVIL
KATALVSLLGLEDVVKATQLAGKSTWEPFYFAVVCGVIYLVFTTASNGVLLLLERRYSVG
VKRADL
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
gtgggaggggaaaagacacggttccaccactcacgatacgacagggctcgcggtatgctg
tacggattttctggcgttattttacagggcgcgcttgtcacccttgagctggctctcagc
tccgtggtgctggcggtgctgataggtctggcgggcgcaggggcgaagctttcggctaac
aagccgctggcgctgatttttgaaggctatacgacgctgattcgcggtgttcccgatctg
gtgctgatgcttctgatcttttacggtctgcagattgcgcttaacagcgtgacggacgca
atgggtatgggacaaatcgatatcgacccgatggtggccggtattattacgctcggtttt
atctacggggcctacttcaccgaaaccttccgcggcgcgtatatggctgtgccgaaaggc
cacattgaagcggcaaccgcattcggtttcacctcctcacagacgtttcgtcgaatcatg
ttcccggccatgatgcgctatgcgcttccaggtatcggtaacaactggcaggttattctt
aaggcaaccgcgctggtctctctgcttggcctggaagatgtggtgaaagcgacccagctt
gccggcaaaagcacctgggagccgttctactttgcggtggtatgtggcgtaatctatctg
gtctttacaaccgcctccaatggtgtgctgcttctgctcgaacgtcgctactccgtgggt
gtgaagagggctgatctgtga

DBGET integrated database retrieval system