KEGG   Enterobacter cloacae EcWSU1: EcWSU1_03658Help
Entry
EcWSU1_03658      CDS       T01652                                 

Gene name
yqeF
Definition
(GenBank) putative acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
eec  Enterobacter cloacae EcWSU1
Pathway
eec00071  Fatty acid degradation
eec00072  Synthesis and degradation of ketone bodies
eec00280  Valine, leucine and isoleucine degradation
eec00310  Lysine degradation
eec00362  Benzoate degradation
eec00380  Tryptophan metabolism
eec00620  Pyruvate metabolism
eec00630  Glyoxylate and dicarboxylate metabolism
eec00640  Propanoate metabolism
eec00650  Butanoate metabolism
eec00900  Terpenoid backbone biosynthesis
eec01100  Metabolic pathways
eec01110  Biosynthesis of secondary metabolites
eec01120  Microbial metabolism in diverse environments
eec01130  Biosynthesis of antibiotics
eec01200  Carbon metabolism
eec01212  Fatty acid metabolism
eec02020  Two-component system
Brite
KEGG Orthology (KO) [BR:eec00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    EcWSU1_03658 (yqeF)
   00630 Glyoxylate and dicarboxylate metabolism
    EcWSU1_03658 (yqeF)
   00640 Propanoate metabolism
    EcWSU1_03658 (yqeF)
   00650 Butanoate metabolism
    EcWSU1_03658 (yqeF)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    EcWSU1_03658 (yqeF)
   00072 Synthesis and degradation of ketone bodies
    EcWSU1_03658 (yqeF)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EcWSU1_03658 (yqeF)
   00310 Lysine degradation
    EcWSU1_03658 (yqeF)
   00380 Tryptophan metabolism
    EcWSU1_03658 (yqeF)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    EcWSU1_03658 (yqeF)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EcWSU1_03658 (yqeF)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    EcWSU1_03658 (yqeF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:eec04147]
    EcWSU1_03658 (yqeF)
Enzymes [BR:eec01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     EcWSU1_03658 (yqeF)
Exosome [BR:eec04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EcWSU1_03658 (yqeF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AEW75086
UniProt: G8LD80
Position
complement(3821949..3823151)
Genome map
AA seq 400 aa AA seqDB search
MSFNTEVVMKDVVIVGALRTAIGCFQGALSRHSAVDLGSVVVKALVERSGIAAHEIDEVI
LGQVLTAGAGQNPARQAALKGGLPNTVSAITINDVCGSGLKALHLATQAIQCGEADVVIA
GGQENMSRAPHVLTDSRTGAQLGNSQLLDSLVHDGLWDAFNDYHMGVTAENLAREYGISR
ELQDAYALSSQQKARAAIDAGRFRDEIVPVSTQRQNGEVAVVDTDEQPRTDASAEGLARL
NPAFETQGSVTAGNASSINDGAAAVMMMSESKALELDLPVLARIKAFASVGVDPALMGIA
PVYATRRCLERAGWQLSDVDLIEVNEAFAAQAISVGKMLEWDPLRVNVNGGAIALGHPIG
ASGCRILVSLVHEMKKRNARKGIATLCIGGGQGVALAIER
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtcatttaacacagaggttgtgatgaaagatgtcgttatagtgggtgcgttgcgtacg
gctatcggctgttttcagggggcgctttcacgccactcggctgttgatttgggcagcgta
gtggtgaaagcgctggtggaacgcagcgggattgcagcacatgaaattgatgaggtgatc
ctgggacaggtgctgaccgccggtgccgggcaaaaccctgcccgtcaggcggcgctcaag
ggtggcctgcccaataccgtctccgctatcaccatcaacgacgtctgtggctcagggtta
aaagcgctgcatctggcgacgcaggccattcagtgtggtgaagcggatgtcgtgattgcc
ggcggacaagaaaatatgagccgggcaccacacgtgctgaccgacagccgtaccggcgcg
cagctgggcaacagccagttgctcgacagtctggtgcatgacggtctgtgggatgcgttc
aatgactatcatatgggcgtgacggcggaaaatctggcacgtgagtatggtatcagccgt
gagttgcaggacgcttacgcgttaagctcgcagcaaaaagcgcgcgcggcgattgatgcc
gggcgctttcgggatgaaatcgtcccggtcagcacgcagcgtcagaacggtgaggttgcc
gtggtggataccgatgagcagccgcgcaccgacgccagcgctgaagggctggcgaggctc
aatcctgcgtttgaaactcagggctcagtgacggcgggaaacgcctcctccattaatgat
ggcgctgcggccgtgatgatgatgagtgaaagcaaagccctcgagctggatctgcccgtc
ctggcccgcattaaggcatttgccagcgtgggtgttgatcctgcgttaatgggtatcgcc
ccggtttatgctacccgtcgctgcctggaacgcgcagggtggcaactctctgatgtggat
ctgattgaagtcaacgaggcctttgccgcacaggcaatctcggttggcaaaatgctggaa
tgggatcccctgcgggtaaacgtgaacggtggggcaatcgcactgggtcatcctatcggc
gcgtccggttgtcgaattctggtatcgctggtgcatgagatgaaaaagcgcaatgcccgc
aaaggcattgcgacgctctgtatcggtggtggacaaggtgtcgccctcgccattgaacgc
taa

DBGET integrated database retrieval system