KEGG   Electrophorus electricus (electric eel): 113567551Help
Entry
113567551         CDS       T05787                                 

Definition
(RefSeq) leukotriene B4 receptor 1-like
  KO
K04296  leukotriene B4 receptor 1
Organism
eee  Electrophorus electricus (electric eel)
Pathway
eee04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:eee00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    113567551
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:eee04030]
    113567551
G protein-coupled receptors [BR:eee04030]
 Rhodopsin family
  Lipid
   Leukotriene
    113567551
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Sru 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 113567551
NCBI-ProteinID: XP_026851399
Position
Unknown
AA seq 309 aa AA seqDB search
MEHGNGSDLDSAGDLSRANLVSSVLMGLFCAVGIPGNAVVVVVILLWFKKDNFTVQLMLN
LAASDILSLMTLPMWMYNQLNVWRIGRTLCKSLVLLAYCSVYSSLLTVTVMSVHRCMQVC
YPKRWAKLGKRGETALLLTIWILGLACSVPPVLTQEVLQKGTKKECGRIMSQDNHRLFVT
VLETLLAFVIPFSIMVTSYYCIHKKVTRGALFRSRRMTRIVTRIVVTFFIFWTPYHIINL
VEIAGILLKKSQPHSADKLLLFINSLGDVAGSFTFINSCVNPLLYAFASRSLRQSSKTEH
TNTLPTSSV
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggaacacggcaacggcagtgatctagactccgctggtgatttgtcccgggccaacctg
gtcagctccgtgctcatgggcttgttctgtgccgtaggaattcccggcaatgcggtggtg
gttgtggtcatcctactctggttcaagaaggacaacttcactgtgcagctgatgctaaac
ctggctgcctccgacatcctgagtctgatgacgctgcccatgtggatgtacaaccagcta
aatgtgtggcgcatcggacggacgctctgcaagtccctggtcttgctcgcctactgcagt
gtgtattccagtctactgaccgttaccgtgatgagtgtccatcgctgcatgcaggtctgc
taccccaagaggtgggccaagctggggaagagaggagagacagctcttctcctcaccatc
tggattcttggacttgcttgttctgttcctccggtcctcacacaggaggtgctacagaaa
ggcaccaaaaaggaatgtgggagaataatgtcccaggacaaccacaggctgttcgtgaca
gttctagagacgctgctggcatttgtcattccgttctccatcatggtcacgtcctactac
tgcatccacaagaaggtgacacggggagcgctattccgcagccgaaggatgactcggatt
gtgacccggattgtagtgactttcttcatattctggacaccgtaccacatcatcaacttg
gtagaaatcgctgggattctgctgaaaaagtcacagccgcactctgcagataaactgctg
ctgttcataaattccctgggtgatgttgctgggagtttcacattcatcaacagctgtgtg
aaccctcttctttacgcctttgcttcgcggagccttcgccagagttccaagacagagcac
acaaacacgcttccaacctccagcgtttaa

DBGET integrated database retrieval system