KEGG   Electrophorus electricus (electric eel): 113568060
Entry
113568060         CDS       T05787                                 

Gene name
mecom
Definition
(RefSeq) MDS1 and EVI1 complex locus protein
  KO
K04462  ecotropic virus integration site 1 protein
Organism
eee  Electrophorus electricus (electric eel)
Pathway
eee04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:eee00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113568060 (mecom)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:eee03000]
    113568060 (mecom)
Transcription factors [BR:eee03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    113568060 (mecom)
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-C2H2_6 zf-C2H2_jaz zf-H2C2_5 zf-C2H2_8 zf-BED PyrI_C zf-C2H2_11
Other DBs
NCBI-GeneID: 113568060
NCBI-ProteinID: XP_026852031
Position
Unknown
AA seq 995 aa
MKAEEFSCDTMAPDIHEERQFRCDDCERHFDSGRELMEHQEHACVTRADAAFTLPEQGLP
GTGRASELDPLRLPPPTLHPAHSPYECKECEQVFPDTQSLEAHSLSHSEEREYKCDQCPK
AFNWKSNLIRHQMSHDSGKHYECENCSKQVFTDPSNLQRHIRSQHVGARAHACPDCGKTF
ATSSGLKQHKHIHSSVKPFMCKSLTPFICEVCHKSYTQFSNLCRHKRMHADCRTQIKCKD
CGQMFSTASSLNKHRRFCEGKNHFAAAAGGLFGPAMALPGGPGLDKSTLGAMGPGSGGLA
DYFGTNRHHGGLTFPAAPPAFPFSFPGLFPSGLYHRPPLIPATSPIKGPPSADLRKSPVL
SSPVSATQETHDLLKSFRKHSTSINGEGVDKTEQRRDGSASKPRHGIKMSDQSESSDLDD
VSTPSGSELESTSGSELDSDAESDRDRVPGRENGKGPKRKSGASVLGRSPALVSSGGSSA
GNGSGSDAPPPGLFSPAMDENTAVSGAVNDSIKAIASIAEKYFGSTGLAGLHDKKGSALS
YPSMFPLSFFPAFSPPIYPFHERDHMRPAGHKGEPESPPAEGKRPQGRSGESPFDLTTKR
KEERSALAFAPSKPEVPRSAAANQDQPLDLSLGGRSRGPKVEESRKNRVFGEEKTEPEPP
KAEPSLQHARPTPFFMDPIYSRVEKRKASDPFEALKEKYMRPAPAFLLHPQFRMPDQRTW
MSAIENMAEKLETFSSLKSDPSDIMRSVPSMFDFRAPTTLPESLLRKGKERYTCRYCGKI
FPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHIRNIHNKEKPFKCHLCDRCFGQ
QTNLDRHLKKHENGHLSGTAMSSPQSELDNGSAILDDKEDAYFNEIRNFISNSSQRAGSP
PHSDEGLNDSHFVGDKAVTNQGSHDIEEEEGEEHGAEEEEAEHSDAVGKLGIKAPPNNLG
DGITDDLDFDGPNHLDMNCKSSPQRYAMTVGFLQV
NT seq 2988 nt   +upstreamnt  +downstreamnt
atgaaggctgaggagttttcatgtgacacaatggctccagatattcatgaggagcgccag
ttccgctgtgatgactgtgagcgccatttcgactcggggcgagagctcatggagcaccag
gagcacgcctgcgtgacccgggctgacgcggccttcaccctgcctgagcaaggcctccca
ggcacagggagagccagtgagctcgaccccctccgcctgcccccacccacactacacccg
gcccactccccgtatgagtgcaaggagtgtgagcaagtgtttcctgatactcagagtctt
gaggctcactctctctctcattctgaggagagggagtataaatgtgaccagtgcccaaag
gccttcaactggaagtccaacctgattcgccaccaaatgtcacatgacagcggcaagcac
tatgaatgtgaaaactgctcaaagcaggtgttcacagaccccagtaacttgcagaggcac
atccgctcccagcacgtgggtgctcgggcacatgcctgccccgactgcgggaagacattc
gccacctcctccggcctcaagcagcacaaacacatccactcctccgtcaagcccttcatg
tgtaagtctctcacccccttcatatgtgaggtgtgccataagtcctacacccagttctca
aacctgtgcagacacaagcgcatgcacgctgactgccgcacgcagattaagtgcaaagac
tgcgggcagatgttcagcaccgcctcctccctcaacaagcaccgccgcttctgcgaggga
aaaaaccatttcgctgccgctgcaggagggctctttggtcctgccatggccctccctggc
ggccccggcctggacaagtccaccctgggcgcaatggggcccggctcgggcggcctggcc
gactattttggcacgaaccgtcaccacgggggcctcacgttccctgccgcgcctccggct
ttcccgttcagttttccggggttgtttccatccgggctgtaccaccggccaccgctcatc
ccagccacttcccccatcaaaggcccaccgagcgcggacctgcggaagagtccggttctt
tcctcgcctgtgtcagcaacccaggagacgcatgacctcctgaaaagcttccgcaagcac
tccacctccatcaacggggagggcgtggacaagacggagcaacggagggacggctccgcc
tccaagccgcggcacggcattaagatgagtgaccagtcggagagcagcgatctggacgac
gtcagcacaccgagtggaagtgagctggaaagcacttccgggtcggagctggacagcgat
gccgagagcgaccgggaccgggtaccgggccgggaaaacgggaaaggcccaaaaaggaag
tccggcgcttccgtcctcggccggagtcccgccctcgtcagctcgggcggcagcagtgcc
ggcaacggtagcgggagcgacgcgcctccgcccggactgttctccccggccatggacgag
aacaccgccgtgtccggagcagtcaacgactccatcaaggccattgcttctatcgcagag
aagtactttggctccacggggctggcagggctgcacgacaagaaagggagcgccctgtct
tacccttccatgttcccactctccttcttccctgccttctctccccccatctaccccttc
cacgagagggaccacatgcgacccgcgggccacaagggggagccagagagcccgccagcc
gagggcaagaggccgcagggcaggagcggcgagtccccctttgacctcaccaccaagcgc
aaagaggagcgctcggcactggccttcgccccgtcgaagccggaggttccgcgctcagcc
gcggccaatcaggatcagccgcttgacctgagcctcggcgggcggagccgaggcccaaaa
gtggaggagtcgcgcaagaaccgcgtatttggagaggagaaaacggagccggagcctcct
aaagcagaaccctccctccagcacgcgagacccaccccattcttcatggaccccatctac
agcagggttgagaagaggaaagccagcgatccgttcgaggccctgaaggagaagtacatg
cggcccgcgcccgccttcctcctccacccgcagttccgcatgcctgatcagagaacctgg
atgtctgcaatagaaaacatggcagagaagttggaaacgttcagctcgttgaagtcagac
cccagtgacatcatgcggtcggttccctccatgtttgatttccgagcgcccaccacactg
ccagagtctctgctacgcaagggcaaggagcgctacacctgcagatactgtggcaaaata
ttcccacggtcagccaacctcacacgccacctcagaacacacacaggagagcagccatac
aggtgtaagtactgtgatcgatcgttcagtatctcctcaaacctgcagcgacacatccgg
aacatccacaacaaggagaaacccttcaaatgccacctgtgtgaccgctgcttcggacag
cagaccaacctggaccggcacctcaaaaaacacgagaacgggcatttatcaggcacagcg
atgtcgtcccctcagtcggagctggacaacggcagtgccatcctggacgacaaggaagac
gcctactttaacgagatacgcaacttcatcagtaacagcagccagcgtgccggctcaccg
ccgcactccgacgaagggttgaatgacagccattttgtgggggacaaagctgtcactaat
caggggtcacatgacattgaggaggaggaaggggaggagcatggggcagaggaagaggaa
gcagagcatagcgacgctgttggcaaactcggtattaaggctccgccgaacaacctgggt
gatggcatcacggatgacctagactttgatgggccaaaccatctggatatgaactgcaaa
tcttcaccacagagatatgccatgaccgtcggcttcctccaggtttga

DBGET integrated database retrieval system