KEGG   Electrophorus electricus (electric eel): 113568158Help
Entry
113568158         CDS       T05787                                 

Definition
(RefSeq) dedicator of cytokinesis protein 7-like
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
eee  Electrophorus electricus (electric eel)
Brite
KEGG Orthology (KO) [BR:eee00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:eee04131]
    113568158
Membrane trafficking [BR:eee04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    113568158
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2
Motif
Other DBs
NCBI-GeneID: 113568158
NCBI-ProteinID: XP_026852137
Position
Unknown
AA seq 1561 aa AA seqDB search
MVNKRNLLYVYPQSLNFSSRQGSVRNIAVKVQFMEGEDPSQAMPVIFGKSSCSEFYKEAY
TPVIYHDKSPEFYEEVKMKIPANLTDNHHLLFTFYHISCQPKQNTPLETPVGYTWVPLMQ
HGRLRTGSFSLPVSVEKPPPSYSVLTPDVQLPGMKWVDNHKSVFNVEVTAVSSVHTQDPH
LDKFFTLVHVLEEYSFPFRLKDVIITEANVEAELKASMAALKGALLDTCVCFLHQLLNKL
ILLIVHPPVIAGQIVNLGRAAFEAMALLVNQIHKNLEGSQDQHGRSSLLTSYVHYCFHLP
TTETVSPPSGGPPYDLPIHYATLSRATGRPTSLHLSRSKSISNSNPDLASTPTSPDEEVQ
RIIGNKGIDRSHSWVNPAYAPGGPRAVLRRNPNSSCDLKQQASEWGANRMSAFIESSSFL
SPASRHVAHKLLHEELALQWVVSTSTVREAALQQAWFFFQIMEKSMAHHLFLTSRLDVPR
RQRFPDRFVDDIAALVCAISADIASRYHKDVELVERLNSSLAFFVNDLLSLMDRGFVLNL
IRSYYKQISNKLHTAQNPSALTALRMDFLRIVCSHEHYVTLNLPCASLSPPTSPSPSTSS
TTSQDQGVACMFELSVPFRQQHFLSALMLSELALILEPDGEGVFFLQKKAISAVHALLCS
HDVDPRYTDPQVRAHVAQLYLPLIPIVMETLPQLHDFTDISAQRGRHATVIVPDDDPDGS
TISPSVAMAIAGSPLPSSRTGPFPLPAVAGRSTLSAECSRTLLACMLWVLKNAGTALLER
WLSDLSVLHINRLLDLLHLAISCFEYKGRKALERINSLTFKKSQDMKARLEEAILGTIGA
RQEMVRRCRERSPYGSQENVRWRKNVTHWRQNADRVDKTKAEVEQESVVDGNLATEASLI
VLDTLEIIVKTVVLSELKESVLGGVLRVLLHSMAGNQSALFLQHCFTTQRALVYKFPEML
FEEDTELCADLCLRLLRHCSSSISSVRSHASASLYLLMRQNYEIGNNFARVKMQVTMSLS
SLVGTSQNFNEEHLRRSLKTILTYAEEDLELRDSPFPEQVQDLVFNLHMILTDTVKMKEH
QQDPEMLLDLMYRIAKGYQNSPDLRLTWLQNMAGKHSERGNHAEAAHCLVHSAALVAEYL
NMLEDCRYLPIGCVSFQSISSNVLEESAVSDDILSPEEEGICAGKYFSEAGLVGLLEQAA
ASFNMAAMYEVINEVYKILCPIHEANRDFKKLASVHGKLQDAFNKIYNQSSGWERMFGTY
FRVGFYGCRFGDLDEQEFVYKEPSITKLAEISHRLEEFYSERFGDEVVVIIKDSNPVDKS
KLDPNKAYLQITYVEPFFDTYELKERVTYFDKNYNLRTFMYCTPFTLDGRAHGDLHEQYK
RKTILTTSHAFPYIKTRINVIEKEEIILVPIEVAIEDMQKKTQELAFATHQDPADSKMLQ
MVLQGCVGTTVNQGPLEVAQVFLSEIPDDPKLFRHHNKLRLCFKDFTKRCEDALRRNKAL
IGPDQKEYHRELERNYYKLKEALGPLINRKIPQLYRALQPVPTTPTHRNSLSRSSFRRTD
C
NT seq 4686 nt NT seq  +upstreamnt  +downstreamnt
atggtaaacaaaaggaacctgttgtacgtgtatcctcagagtctgaacttcagcagcaga
cagggctccgtgcgtaacattgctgtaaaggtgcagttcatggagggagaggaccccagc
caggccatgcctgtcatctttggaaaatccagctgctcagaattctataaagaagcatac
accccagtcatctaccatgacaaatcccctgagttctatgaggaagtcaagatgaagatt
cctgccaatctgactgacaaccaccatctccttttcaccttttaccacatcagctgccag
cccaagcagaatacacccttggagacaccagtgggctacacttgggtccctctgatgcag
catggacgcctgcgcacgggctccttcagcttgcctgtgtctgtggagaaacctccaccc
agctactccgtccttacccctgacgtgcagctgccaggaatgaagtgggtggataatcac
aaaagtgtctttaatgtggaagtgactgctgtctcctctgttcatactcaggaccctcac
ctggataagttcttcaccctggtccatgtcctggaggagtattcattccctttccggctg
aaggatgtgatcatcacagaggccaatgtggaagctgagctgaaggccagcatggctgcc
ctgaagggggctctgctggacacctgtgtgtgcttcctacatcagctgctgaacaagctc
atcctgctcattgtccaccctcctgtcatcgctggccagatcgtaaacctgggtcgtgct
gccttcgaggccatggctctgctggtcaatcagatccataagaacctggagggcagccag
gaccagcacggccgcagcagcctccttacctcctatgtccactactgtttccatctgccc
accactgagactgtgtcgcccccttctggcgggcctccttacgaccttcctatccactac
gccacgttgtcccgggcaacaggccgccccaccagcctccacctgtcccgctccaagagc
atcagcaactccaaccctgacctggcctccacccccacctcacctgatgaggaggtacag
aggatcatcggcaacaagggaatagaccgatctcattcctgggtaaaccctgcttacgct
cctggcggccccagagccgtgcttcgcaggaaccccaactccagctgtgatctcaaacag
caggcctccgagtggggcgctaaccgcatgtcggccttcatcgagagctcctccttcctc
tcaccggcctccaggcacgttgcacacaagttgctgcatgaggagttggctctgcagtgg
gtggtgagcactagcacagtgagagaggcagctctgcaacaggcctggttcttcttccag
atcatggaaaagagcatggcccatcatcttttccttacctcccggctggatgtgcccaga
cgccagcgtttccccgaccgcttcgtggatgacattgctgccctggtgtgtgccatcagc
gcggatatagccagcagataccacaaggatgttgagcttgtggaaagattaaacagcagt
ctggccttcttcgtcaatgacctgctttctctcatggaccgagggtttgtgttgaacctc
atccgatcctactataaacagatctccaataagctgcacacagctcagaaccccagtgct
ctgacagctctgaggatggacttcttacgcatagtgtgtagccatgagcactacgtaaca
ctcaacctgccctgtgcatcactgagccctcccacttcaccctcaccatccacctcgtcc
accacatcccaggaccagggcgtggcctgtatgttcgagctgtccgtgcccttccgtcag
cagcacttcctgtcagccctgatgctgtccgagcttgccctaatcctggagcccgatggg
gaaggtgtgttcttcctgcagaagaaggccatcagtgctgtgcatgccctgctgtgcagc
cacgacgttgaccctcgctacaccgacccccaggtgcgcgcccacgtcgcccagctctac
ctgccgctcatccccatcgtcatggagacgctgcctcagcttcacgacttcaccgatatc
tcggctcagcgcgggcggcacgccaccgtgatagtccctgatgatgacccagacggcagc
accatcagcccgtctgttgccatggcgatagccggctcgccgctgccttcttccagaact
ggccccttccctctgcctgctgtggcgggtcgcagcactctctctgcagagtgtagccgg
acactgttggcatgcatgctctgggtgctgaagaacgctggcactgccctgctagaacgt
tggctctccgacctctctgtgctgcacatcaaccgcctgctcgacctgcttcaccttgcc
atctcctgtttcgagtacaaggggagaaaggctctggaacggatcaacagtctgaccttc
aagaagtctcaggacatgaaggcccgtctggaggaggccatcctcgggaccatcggggcc
cggcaagagatggtccgccgttgccgcgaaaggagcccttatggcagccaagagaacgtt
cggtggcggaaaaatgtgactcactggagacagaatgcagaccgagtggacaaaacaaaa
gcagaggtggagcaggaatcagtggtggatgggaacttggctactgaagcgtctttaata
gtcctggacactctggaaatcatcgtcaaaacggtggtgctgtcagagcttaaggagagt
gtgcttggtggagtgctgagagttctcctccatagcatggctgggaaccagagtgccctc
tttctgcagcactgcttcactacacagagagcactggtctacaagtttcctgagatgctg
tttgaggaggacaccgagctgtgtgctgatctgtgtcttcggttactccgtcactgcagt
agcagtatcagctctgtacgcagccatgccagcgcctccctctacttgctcatgagacag
aactatgagatcggcaataactttgcccgggtgaagatgcaggtgactatgtccctgtca
tctctggttggcacctcgcagaacttcaatgaggaacacctgcgccggtccctcaagacc
atcctcacctatgctgaagaagatcttgaactcagagactcacccttccctgagcaggtt
caggacctggttttcaacctacacatgatcctgactgacacggtgaagatgaaggagcac
cagcaggaccctgagatgctgctggacctcatgtacaggattgccaagggttaccagaac
tccccagacctgcggctcacctggctgcagaacatggctggcaagcactcagagaggggc
aatcatgcagaggctgcccactgcctggtccacagtgccgcactggtggccgagtatctc
aacatgttagaggactgccgctaccttcccatcggctgcgtctctttccagagtatctca
tccaacgtgctggaggaatcggccgtgtctgacgacatcctgtcccctgaggaggagggc
atctgtgcgggaaagtacttcagcgaagctggcctggtgggactgttggagcaggcggct
gcctccttcaacatggctgccatgtatgaagtcataaatgaggtatataagattctctgc
cccatccatgaggccaacagagacttcaagaagctggcttctgtccatggcaagctacag
gatgccttcaacaaaatctacaaccagagttcaggatgggagaggatgtttgggacttac
ttccgtgtgggtttttacggctgtcgcttcggagacctggatgagcaggagtttgtgtac
aaagagccgtctatcaccaagctagcagagatctctcacagactggaggagttctattca
gagcgctttggtgatgaagttgttgtgatcatcaaggactccaaccctgtagacaagagc
aaactggaccccaacaaggcctacctgcagatcacatacgtggagcccttctttgacaca
tatgagctgaaggaacgcgtcacctactttgacaagaactacaatctgcgtacgttcatg
tactgcacgccattcacactggacggccgtgcccatggtgacctgcacgaacaatacaaa
cgcaagaccatcctcaccacgtcccacgcattcccctacattaagacccgcatcaacgtc
attgagaaggaggagataatcttggttcctattgaggtggccatcgaagacatgcagaag
aagacccaggagctggcctttgccacccaccaggaccccgccgactcaaagatgcttcag
atggtgctgcaaggttgcgtgggcaccaccgtcaaccagggtcctctggaggtggcccag
gtcttcttgtctgaaattccagacgatccaaaactcttccggcatcacaataagctgcgc
ctttgctttaaggacttcaccaagagatgtgaggatgctctgcggaggaacaaagccctg
attgggccagatcagaaggaataccatcgggagctggagaggaactactacaagctgaag
gaggctctgggtcccctcatcaaccgcaagatcccccagctgtacagggcactgcagcca
gtgccaaccacacccacacacaggaactccctcagcaggtccagttttcgcaggactgac
tgctga

DBGET integrated database retrieval system