KEGG   Electrophorus electricus (electric eel): 113570698Help
Entry
113570698         CDS       T05787                                 

Gene name
gba
Definition
(RefSeq) glucosylceramidase
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
eee  Electrophorus electricus (electric eel)
Pathway
eee00511  Other glycan degradation
eee00600  Sphingolipid metabolism
eee01100  Metabolic pathways
eee04142  Lysosome
Brite
KEGG Orthology (KO) [BR:eee00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    113570698 (gba)
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    113570698 (gba)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    113570698 (gba)
Enzymes [BR:eee01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     113570698 (gba)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C Glyco_hydro_59 CAP
Motif
Other DBs
NCBI-GeneID: 113570698
NCBI-ProteinID: XP_026855068
Position
Unknown
AA seq 520 aa AA seqDB search
MRESAFLVLCLLLTSPTSQITVASDGCQARTFGQSSTVCECNATHCDSVGLVRLPAVGNF
LTFLSSQAGSRLQKEQSQVQRNSSGTALRITLVPMQKYQHVKGFGGAMTDAAAMNILSLS
DGTQDQLLRQYFSPEGIEYNVIRVPMASCDFSTRLYTYADSPNDYSLLNFSLREEDVHMK
IPLLQRAQALSSRPLALFASAWSAPGWLKTNGALIGKGSLKGKPGGKEHKTWAQYYIRFL
DEYKKHNLSFWGLTTGNEPTAGKMTNYSFQALGFTPETQRDWIALDLGPALHSSPYAKTR
LMILDDQRLLLPYWAKVVLGDIHAARYVHGIGVHWYWDHFAPAKITLTTTHNLYPEYFLF
GTEACSGWNKLDPGVRLGSWERAEAYAHDIIEDLNNYVSGWTDWNLALNLEGGPNWVKNF
VDSPIIVNQRSDVFYKQPAFYSMAHFSKFLWEGSQRVGVSVSQHTDLESTAFIRPDGSAV
LIVLNRSDAEVTFELWDQPVGFLPAAAPPHSILTLLWARS
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgagggagtctgcatttcttgttctttgccttcttcttacttcgccgacctcacaaatc
acagttgccagcgatggctgtcaggcgaggacgtttggccagagctcaacagtgtgtgag
tgtaacgccacacactgcgactctgtcggcctggtccgcctgcctgctgtgggcaacttc
ctgacgttcctgagcagtcaagcgggtagcaggcttcagaaggagcaatctcaggttcag
aggaacagcagtggtacagctctcaggatcactctggtgcccatgcagaagtaccagcat
gttaagggttttggcggagccatgacagacgcagcagctatgaacattctgtccctgtcg
gatggaacgcaagaccagcttctcagacagtacttttccccagagggtatagagtacaat
gtgatcagagtgccaatggccagctgtgatttttcaactcgcctttacacctatgccgat
tcacccaacgactacagcttgctcaactttagcctgcgtgaggaagacgtgcacatgaag
atccccctactgcagcgggcccaggctctgtcctctcgccccctggctctgtttgcttcg
gcctggagcgcccctggctggttaaagaccaatggtgcactaataggaaagggctccctt
aaaggcaagccagggggaaaggagcacaagacctgggcacagtattatatcaggtttctg
gacgagtataagaaacacaacctttcattttgggggctgaccactggcaacgagcccaca
gcaggcaaaatgaccaattacagcttccaggctttgggattcacgccagaaacccaacgt
gattggattgcgttggaccttggtcctgccctccattcctccccatatgcgaagacccgc
ctaatgatcctggatgaccagagactcctacttccttattgggccaaagtggttctgggt
gacatacatgcagcacgctatgtacatggcatcggtgttcactggtactgggaccacttt
gctcctgccaaaatcactctgacgaccacacataatctctaccctgagtacttcctattt
ggcactgaagcgtgctctggctggaacaagcttgaccctggagtgcggctgggaagctgg
gaaagagctgaggcctacgctcatgacattatagaggacctaaataattatgtgagcggg
tggacagactggaacctagcactaaaccttgaaggtgggccaaactgggtgaagaatttt
gtggacagccccatcatagtcaaccagaggagtgatgttttctacaaacagccagccttc
tacagcatggcgcacttcagcaagttcctgtgggagggatctcagagagtgggtgtgtca
gtttctcaacacactgacctggaaagcaccgccttcatcagacctgatggctcagcagtg
ctgattgttttgaacaggtctgatgcagaggtgacgtttgagttgtgggatcagccggtc
ggctttctgccagcagctgctcctccccactccatacttacgctgctctgggctcgctcc
tga

DBGET integrated database retrieval system