KEGG   Electrophorus electricus (electric eel): 113571913
Entry
113571913         CDS       T05787                                 

Definition
(RefSeq) uncharacterized protein LOC113571913
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
eee  Electrophorus electricus (electric eel)
Brite
KEGG Orthology (KO) [BR:eee00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:eee03000]
    113571913
Transcription factors [BR:eee03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    113571913
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_9 PAS_4
Other DBs
NCBI-GeneID: 113571913
NCBI-ProteinID: XP_026856924
Position
Unknown
AA seq 664 aa
MIPPGDCMYAGRKRRKPVQKHRKPAPVTEKSNPSKRHRDRLNAELDRLASLLPFSPEIIS
KLDKLSVLRLSVSYLRVKSFFQANEEKPSRKHSPAVHEARKENVSHVPYISESELLLESL
TGFALVVSSDGMVFYASSTIVDYLGFHQTDVMHQNVFDYIHVDDRQEFRSQLHWAMNPSQ
QGSEQHLATGTGEDIVLSNLFHSQEAGGVPPEFSSFLNRCFISRVRCLLDSTSGFLTMQI
QGRLKFLNGQKKKTTSGVTLPPQLALFCVAVPLLLPSITEMKMKSVMPRGKHKNMAHNMN
ISLDHSDREGTLRRQSVVSEGGDSAFLNCSTPVGSSRLQSPWAALSKDSFKYKNEDYYNQ
EEPLNYSQEETLSFYKSSAGGQKGPHGETMWPLRASCGPVRTGHGLRLLPAGRTGSQYGK
PYRMSPIYHNSRAELYVPKLYGSLLHPGEMEGNYMEGIKSENGCYEGHLQGYDERLMAEL
PIKVEQDSDSENGCDVYGQPWTGRERYPDPYESSPQLKAEGGFYEQYPTCLRGRGSNGLS
YSSHFQNACAVTARPLKCVLDKDAEAPSPQRPGHLDPLSSGQTTSCMESYAVGPGEHKAY
MQQDYKLSYEFKRQGLLHSIKREPMDSPPWPDSQPDQLRLERNITPNCIMNVGQSKANPY
IFMQ
NT seq 1995 nt   +upstreamnt  +downstreamnt
atgataccacctggggactgcatgtatgccggacggaagcggaggaagcctgtacagaaa
cacagaaaaccagccccagtgacagagaagtccaacccgtcgaagcggcaccgggatcgt
ctgaacgcagagttagatcgactggcgagcttgctgcccttctcgcccgaaatcatctcc
aaactggacaagctgtctgtgctgcgactcagtgtcagttacctacgcgtcaagagtttc
ttccaggccaatgaggagaagccatctaggaaacacagccctgctgttcatgaggctagg
aaggagaatgtctcacatgtgccttacatttctgagagtgagctcctactcgagtctcta
actggatttgctctggttgtaagcagtgatggaatggtcttctacgcttcatccaccata
gtggattatctgggcttccatcagactgatgtgatgcaccaaaatgtctttgactacatt
catgtagatgacaggcaggagtttaggagccagctacattgggccatgaacccatctcag
cagggctcggagcagcaccttgccacaggaactggagaagatattgtgctcagcaacttg
ttccactcccaggaggcaggtggcgttcctccagagttttcttctttccttaatcgttgt
ttcatctcgagagtccgctgtctcctggacagtacctccggattccttacaatgcaaatc
caagggcgtttgaagttcctgaatggccagaagaagaagacaacatccggtgtgactctt
ccccctcagctcgctctgttctgtgtggcagtgcctctcctcctgccctccatcacagag
atgaagatgaagagtgtgatgccacggggcaagcacaaaaacatggcccataacatgaat
atatccttagatcacagtgacagagaggggaccttaagacggcagtcagtggtgagtgaa
gggggagactcagcattcctgaactgctccacacctgtaggaagctcacgcctccagagc
ccctgggcagcgctttccaaggacagcttcaagtacaagaatgaggactactacaatcag
gaagaaccacttaactatagccaggaagagacactcagcttctataaatcctctgctggg
ggccagaaaggtccacacggagagaccatgtggcctttgagagcctcttgtgggcctgtc
cgtacaggtcatggactcagactgctacctgctgggagaacagggagtcagtatgggaaa
ccctatagaatgtcccccatttatcacaacagcagagcagagctttatgttccaaagctt
tacggaagtcttctgcacccaggagaaatggaaggaaattacatggagggaatcaagagt
gaaaatggatgttatgaaggccacctgcaaggctacgacgaacgtctaatggctgagctg
ccaatcaaggtagagcaggactctgactctgaaaatggttgtgacgtttatggccagccc
tggacaggtcgtgagcgttacccagacccgtacgaaagtagcccgcagctgaaagcagaa
ggtggcttctacgagcagtatccaacatgcctaaggggcagggggagtaacgggctgtct
tacagcagccactttcagaatgcctgtgctgtaactgcacggccactaaagtgtgtcctc
gataaagatgcagaagctcccagcccccagcgcccaggtcacctggacccactgagcagt
ggccaaactaccagctgcatggagagctatgctgttgggccaggagagcacaaggcctat
atgcagcaggattacaagctcagctatgagttcaaaaggcagggcctcctgcattctatc
aagcgtgagcccatggactcaccaccctggcccgacagccaaccggaccagctaaggctg
gagaggaacatcacgccaaactgcatcatgaatgttgggcagtccaaagctaatccatat
atctttatgcaatag

DBGET integrated database retrieval system