KEGG   Electrophorus electricus (electric eel): 113572944Help
Entry
113572944         CDS       T05787                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: calcium/calmodulin-dependent protein kinase type II subunit beta-like
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
eee  Electrophorus electricus (electric eel)
Pathway
eee04012  ErbB signaling pathway
eee04020  Calcium signaling pathway
eee04114  Oocyte meiosis
eee04217  Necroptosis
eee04261  Adrenergic signaling in cardiomyocytes
eee04310  Wnt signaling pathway
eee04912  GnRH signaling pathway
eee04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:eee00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    113572944
   04310 Wnt signaling pathway
    113572944
   04020 Calcium signaling pathway
    113572944
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    113572944
   04217 Necroptosis
    113572944
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    113572944
   04916 Melanogenesis
    113572944
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    113572944
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:eee01001]
    113572944
Enzymes [BR:eee01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     113572944
Protein kinases [BR:eee01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   113572944
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CaMKII_AD Pkinase Pkinase_Tyr DUF4440 SnoaL_3 SnoaL_2
Motif
Other DBs
NCBI-GeneID: 113572944
NCBI-ProteinID: XP_026858719
Position
Unknown
AA seq 451 aa AA seqDB search
MGVVHRDLKPENLLLASKCKNAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVLRKE
AYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNLI
NQMLTINPAKRITAQEALKHPWVCQRSTVASMMHRQETVECLKKFNARRKLKGAILTTML
VSRNFSAAKSLLNKKADVKKRKSSSTVQYMESSDSSNATVEDEDTKASTKFTDLLGTVRK
GPGPVPDGEGCGLTPLVAQPTSVPCPAPHIPNVPMQMSRLTDLVSGVRKSTAPQADADRP
NPXPPLQPPSSPLPPVHSRKQEIIKITEQLIEAINNGDFEAYAKICDPGLTSFEPEALGN
LVEGMDFHRFYFENLLSKNSKPIHTTILNPHVHLIGEDAACIAYIRLTQYVDGQGRPRSS
QSEETRVWHRRDSKWQNVHFHCSGAPAAPLQ
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtggtgcaccgagatctgaagccagagaacctgctcctggccagcaagtgtaag
aacgctgcagtgaagctggcagattttggcctggctatcgaggtgcagggagaccagcaa
gcatggttcggatttgcaggcacaccaggatatctgtcccccgaagtgctgaggaaggag
gcatatggaaaacctgtggacatctgggcctgtggtgtgatcctctacattttgctggtt
ggctatcctccgttttgggatgaagaccaacacaaactctaccagcagattaaagctgga
gcttatgattttccgtcgcccgagtgggacacagtcactccggaagccaaaaacctgatc
aaccagatgctgaccatcaatccagccaagagaatcacggctcaggaggctcttaaacac
ccgtgggtctgccaacgctccacagtggcttcgatgatgcacagacaagagacagtggag
tgcctgaagaagttcaatgcccggaggaaactcaagggagctatcctcaccaccatgctg
gtgtcgcgaaacttctcagcagccaagagtttactgaacaagaaggcagatgtcaagaag
aggaagtcaagctccacagttcagtacatggagtcgtctgacagcagtaacgccacagtg
gaggacgaggacacgaaagcttcgaccaagttcacagacctgctgggtacagtgcgcaag
ggcccaggccctgtgcctgacggagaggggtgtggcctcacccccttggttgctcagccc
acctctgtgccctgccccgccccccacatccccaacgttcccatgcagatgtcgcgtctg
acggacctggtgagtggcgtgcgcaagagtacggccccccaggcagacgccgatcggccc
aaccctncccctcctctccagcccccctccagccccctgcctcctgtgcactcgcgcaag
caggagatcatcaaaatcacagaacagctgattgaggcgatcaacaacggagactttgaa
gcttatgcaaaaatctgtgaccctggtttaacctcgttcgagcccgaggctctgggaaac
ctggtggaaggaatggacttccaccgattctactttgagaacttgttgtccaagaacagc
aagcccatccacaccaccattctgaaccctcatgtccacctgatcggcgaagacgccgcc
tgcatagcctacatccgcctcacgcagtacgtggatggacagggccggccgcgcagcagc
caatcggaggagacgagggtgtggcatcgccgggactccaagtggcagaatgtccatttc
cactgctcaggagcgcctgccgctcctctccagtga

DBGET integrated database retrieval system