KEGG   Electrophorus electricus (electric eel): 113573083Help
Entry
113573083         CDS       T05787                                 

Definition
(RefSeq) sphingosine kinase 2-like
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
eee  Electrophorus electricus (electric eel)
Pathway
eee00600  Sphingolipid metabolism
eee01100  Metabolic pathways
eee04020  Calcium signaling pathway
eee04370  VEGF signaling pathway
eee04371  Apelin signaling pathway
Module
eee_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:eee00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    113573083
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    113573083
   04371 Apelin signaling pathway
    113573083
   04020 Calcium signaling pathway
    113573083
Enzymes [BR:eee01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     113573083
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-GeneID: 113573083
NCBI-ProteinID: XP_026858925
Position
Unknown
AA seq 862 aa AA seqDB search
MRSPGPQSPSPSPPPDPPPGMAQEALLHGQFAGWSSGGIGGGAGGGSGSNGSSSPSTPTG
VSLPLSPASSSYALTLTPTHIHIQRLSPRPGKASWLQLPLAEPTGCSCPRAPAPPLLVLY
WYPPRRRRKGVSRRRNVHAYQAESRTEAEKWNAAVHCLLRGLDVSATTEFSKSMLPRPRR
LLLLVNPFSGRGQAMDWCQTHILPMIREANISYNLIPTKYPSHARELMREIALREWDGII
IVSGDGLLHEVVNGLMDRPDWEQAIKTPVGILPCGSGNALAGSINHYAGYDMCLREPLLL
NCCFLLCRGGIRPMDLVSVTTSPLPSSSSSNQNGHPSTSTRLFSFLSVAWGFVSDVDIES
ERYRGLGSARFTLGTLVRLASLRSYRGRLSYLPPAVVEPAPDSASQPSRRLLSRSITEGL
EGFCRTPIHRTCSDMGISEQRSLSKSDREREREERRERARGTGVVRASSLAEDREREMEA
EQRMEKMSGSSSESNERQEGDGNENESADGEDEEENEGRQKEREREMDMREGYGVEVGKE
AEECEESTADTPPDPRWTLRKNSAPSTQLVNAFFSQPISADSEQDVAMEVDGQQNGSYFQ
RETYLLDPGRERALTISSPFRQSPFSYKPKLPDQNQNRSPSRPRPISLLQHAHSKSLPPK
FPPLSLSQSPMPPSCTSPPSSDYLVPQPNTPGSASFCPSSSSSFSFDLAKPAMSHSSLCP
PPDDDLLPPLDQPLPTRDWVTIEGDFVLVLAIYQSHLGADLLAAPHARFDDGLIHLTFVR
AGISRATLLRLFLAMERGAHLGLSSPYVSHVSARAFRLQPLSPRGTLTVDGELVPYGPLQ
AQIHPSMARLIVGDSGVKITRF
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atgcgctccccagggccccagagcccctccccgtctccacccccagacccgcccccaggc
atggcccaggaagccctgctgcatgggcagtttgcaggctggagcagtggaggaattgga
ggtggggcgggcgggggcagtggttcaaacggcagcagctcccccagcacacctacaggg
gtgtccttgcccctcagccccgcctcgtccagctacgccctcaccctcacccccacccac
atccacatccagcggctgtctccacgtccgggcaaggcctcttggctgcagctgccgctg
gcagagccgacagggtgtagctgcccacgtgcccctgcacctccactgctggtgctctac
tggtacccacccaggcgacgcaggaagggtgtgtccaggcgccgaaatgtgcatgcctac
caggctgagagtcgcaccgaggcggagaagtggaacgcagctgtgcattgtctgctgagg
ggcctggatgtcagcgccactacagaatttagcaaaagcatgctgccccgccctcgtcgt
ctgctgctattggtcaacccattcagtgggcggggtcaggccatggactggtgtcaaacg
catatcctgccgatgatcagagaagccaacatcagctacaacctcatacccacaaagtac
ccgagccatgcccgtgagctgatgagggagattgctctccgtgagtgggatggtatcatc
atcgtctctggagatgggctgctgcatgaagtagttaatggcctcatggaccggccagac
tgggaacaagcaataaaaacacctgtgggaatattgccctgcggctctggaaatgccctg
gccggctccatcaaccactacgcaggatatgacatgtgccttcgggagccactcctcctc
aactgttgcttcctgctttgtcggggtggcatcagacccatggacctggtctctgtgaca
acaagccccttaccatcctcctcctcgtccaatcagaacggccatccatccacgtccacg
aggttgttctccttcctgtcagtggcatggggctttgtgtcagacgtggatattgagagc
gagcgctaccggggacttggctccgcccgcttcaccctgggaacactggtgcgactggcc
tctctgcgctcataccggggccgcctgtcctacctgccccccgccgtggtggagcccgcc
cccgactccgcctcccagccctcgcgccggcttctctcccgcagcatcacggagggccta
gagggcttctgccgcacgcccatccaccgcacctgctctgacatgggcatcagtgagcaa
aggagcctcagcaagagtgaccgggagcgagagagagaggagaggagagagcgggcacga
gggaccggcgtcgtcagggccagcagcctcgctgaggacagagagagggagatggaggca
gagcagaggatggagaaaatgtcggggtccagctcagagtccaacgaaagacaggaggga
gacgggaatgagaacgagtccgcggatggggaggacgaggaggagaacgaggggcggcag
aaagagagggaaagagagatggatatgagggagggatacggtgtggaggtagggaaagag
gcagaggaatgcgaggagagtacagcagacacgcctccagacccgagatggacacttcgt
aaaaactctgccccctccactcagctcgtcaatgcctttttcagccagccaatcagcgcg
gattccgagcaggacgtagcgatggaggtcgatgggcagcagaacggcagctatttccag
cgagagacgtatcttctggacccggggcgtgagcgtgcgcttaccatctcctcccccttc
cgccagtcgccgttctcatacaaaccaaaactcccggaccagaatcagaaccggagtcct
tcaaggccccgccccatctccctcctccagcacgcacactccaaatccctccctcccaaa
ttccccccactctctctgtcgcagtcacctatgcccccgtcctgtacctcccccccaagc
tctgactacctggttccgcagcccaacacgcctggctccgcctccttctgcccctcctcg
tcctcgtccttctcctttgacctggccaagcctgctatgtctcactcctccctctgccca
ccccctgatgatgacctgctgccccctctggaccagcccctgcccacgcgggactgggtg
accatcgagggcgacttcgtcctggtgctggccatttaccagtcacacctgggcgcagac
cttctggctgctccgcacgcacgcttcgacgatggcctgatccacctgacgtttgtgcgg
gccgggatctctcgggccaccctgctgcggctcttcctggccatggagaggggcgcccac
ctcggcctcagctcgccctacgtcagccacgtgtctgcacgggccttccgcctgcagccg
ctctcaccccgcgggaccctcaccgtggacggggagctggtgccctacggacccctgcag
gcacagatacatccttcaatggcccgtctcattgtaggagactctggggtgaagatcacc
aggttctga

DBGET integrated database retrieval system