KEGG   Electrophorus electricus (electric eel): 113574897Help
Entry
113574897         CDS       T05787                                 

Gene name
dhx8
Definition
(RefSeq) ATP-dependent RNA helicase DHX8 isoform X1
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
eee  Electrophorus electricus (electric eel)
Pathway
eee03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:eee00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    113574897 (dhx8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:eee03041]
    113574897 (dhx8)
Enzymes [BR:eee01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     113574897 (dhx8)
Spliceosome [BR:eee03041]
 Complex C
  Other components
   Step II factors
    113574897 (dhx8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OB_NTP_bind HA2 S1 Helicase_C DEAD AAA_22 T2SSE AAA_19 AAA_16 ABC_tran PhoH AAA_30 Flavi_DEAD Sigma54_activ_2
Motif
Other DBs
NCBI-GeneID: 113574897
NCBI-ProteinID: XP_026861918
Position
Unknown
AA seq 1201 aa AA seqDB search
MVDVGEDELKKLEYLSLVSKVCTELDNHLGISDKDLAEFVISLAEKNPTFDGFKSVLLKN
GAEFTDSLVSNLLRLIQTMRQPAKTSTSKGSEPVVKPKSEKDKLKEMFPALCRPDNPNTR
TMLDEDDVKVAADAMKELEMFMPSASGTDSKSSKHRSETTNSSKKTRRSRSRSRSRDRDR
DRDRRRRHSRSRSRSRSPDRERRRRRTRWHSRSRSRSPARGDRERGSDRWKDKHVDRPPP
EEPSVGDIYNGKVTSIMQFGCFVQLEGLRKRWEGLVHISELRREGRVANVADVVSKGQRV
KVKVLSFTGSKTSLSMKDVDQDTGEDLNPNRRRNVAGEGQEESAMRNPDRPTNLNLGHAP
EVEDDTLERKRLTKISDPEKWEIKQMIAANVLSKEEFPDFDEETGILPKVDDEEDEDLEI
ELVEEEPPFLRGHTKQSMDMSPVKIVKNPDGSLSQAAMMQSALAKERREVKQAQREAEMD
SIPMGLNKHWVDPLPDADGRQIAANMRGIGMMPNDIPEWKKHAFGGNKASYGKKTQLSIV
EQRESLPIYKLKEQLIQAVHDNQILIVIGETGSGKTTQITQYLAEAGYTTRGKIGCTQPR
RVAAMSVAKRVSEEYGCCLGQEVGYTIRFEDCTSPETVIKYMTDGMLLRECLIDPDLSQY
AIIMLDEAHERTIHTDVLFGLLKKTVQKRPDMKLIVTSATLDAVKFSQYFYEAPIFTIPG
RTYPVEVLYTKEPETDYLDASLITVMQIHLTEPPGDILVFLTGQEEIDTACEILYERMKS
LGPDVPELIILPVYSALPSEMQTRIFDPAPPGSRKVVIATNIAETSLTIDGIYYVVDPGF
VKQKVYNSKTGIDQLVVTPISQAQAKQRAGRAGRTGPGKCYRLYTERAYRDEMLTTNVPE
IQRTNLASTVLSLKAMGINDLLSFDFMDAPPMETLITAMEQLYTLGALDDEGLLTRLGRR
MAEFPLEPMLCKMLIMSVHLGCSEEMLTIVSMLSVQNVFYRPKDKQALADQKKAKFHQPE
GDHLTLLAVYNSWKNNKFSNPWCYENFIQARSLRRAQDIRKQMLGIMDRHKLDVVSCGKA
TVRVQKAICSGFFRNAAKKDPQEGYRTLIDQQVVYIHPSSALFNRQPEWVVYHELVLTTK
EYMREVTTIDPRWLVEFAPAFFKVSDPTRLSKQKKQQRLEPLYNRYEEPNAWRISRAFRR
R
NT seq 3606 nt NT seq  +upstreamnt  +downstreamnt
atggttgacgtcggagaagacgagcttaagaagctcgaatatttgtctttagtgtctaaa
gtttgtactgaacttgacaaccatttagggatcagcgacaaggaccttgccgaatttgtc
atcagtcttgcggagaaaaatccgacgtttgatggtttcaagtcagtacttcttaagaat
ggagctgagtttacagattcactcgttagcaacttgctcagactcattcaaaccatgcgg
caaccagctaaaacatccacgagtaaagggagtgagcctgttgtcaagccaaagagtgag
aaagataagctaaaggagatgttccctgctttgtgcagaccagataatcccaacactagg
acgatgctggatgaagatgatgtgaaggttgcagcagatgctatgaaagagctggagatg
ttcatgcccagtgccagtggaacagattcaaagagcagcaaacacagatctgaaaccaca
aacagcagcaagaagaccaggaggagcaggagtcgcagtcgaagcagggacagggacagg
gacagggacaggcggagacgccattcccgttcccgctccagatctcgctctccagacaga
gagaggaggaggcgcaggacccgctggcattctcgcagccggtccaggagtccagcccga
ggagacagggagaggggctcagaccgctggaaggataagcacgtggaccggccgcctccg
gaggagccgtcagttggtgacatttacaatggcaaagtcaccagcattatgcagtttggc
tgctttgttcagctggagggcctgaggaaacgttgggaggggttggttcacatctctgag
ctcaggagagaaggcagagtggcaaatgtggcagatgtggtcagcaaaggtcagagggtg
aaggtcaaggtgttgtctttcacaggctcaaagactagccttagcatgaaggatgttgat
caagacactggtgaggacttgaaccctaataggaggagaaacgttgcgggggagggccag
gaggagtcagccatgaggaacccagacagacccaccaacctgaacctgggccatgcccct
gaggtggaggacgacacactagaacgtaagagactcaccaagatctcggatcctgagaag
tgggagatcaaacagatgatagcagccaatgtactctccaaagaggaattcccagacttt
gatgaggagacaggcatcctacctaaagttgatgatgaagaggatgaggacctggagatt
gagctcgtggaagaggagccccctttcttgagaggacacaccaaacagagcatggacatg
agccctgtgaaaatagtgaagaaccccgatggctctctgtctcaggcggccatgatgcag
agcgccctggctaaggagaggcgggaggtgaagcaggcccagcgagaggcagagatggac
tccatccccatgggcctgaacaagcactgggtggaccccctgcccgatgctgatggcagg
cagattgctgccaacatgagaggcatcggcatgatgcccaatgacatccccgagtggaag
aaacacgcctttggcggcaacaaagcttcgtatggcaagaagacacagctgtccatcgtg
gagcagagagagagcctgcccatctacaagctcaaggagcagctcatccaggctgtccat
gataaccagatcttgattgtgattggggagacgggctcagggaaaaccactcagatcact
cagtacttggccgaggcgggatacactacccgtgggaaaattggctgcacgcagcccaga
agagtggccgccatgtctgtggctaagagagtgtccgaagagtacggatgttgtttgggc
caagaggtgggctacaccatccgttttgaagactgcacaagtccagagacggtaatcaag
tacatgacagacggtatgctgctgagagagtgcctcattgaccccgacctcagccagtac
gccatcatcatgttggacgaagcccacgagaggaccatccacaccgacgtgttgttcggc
ctgctcaagaagactgtacagaagcgtcccgacatgaagctcatagtgacctccgctacg
ctggatgccgtgaagttctcccagtatttctatgaggctcccattttcaccatccctggt
cgcacgtacccagttgaggtgctgtacaccaaagaacctgagacagattatctggatgcc
agtctgatcaccgttatgcagatccacctcactgagccaccaggtgatattctggtgttc
ctgacgggtcaggaggagattgacacagcctgtgagatcctgtacgagcgaatgaaatct
ctcggccctgacgtccccgagctgatcatcctgcccgtgtactccgccctgcccagcgag
atgcaaactcggatctttgacccagctccgcctggtagcagaaaggtagtcattgctaca
aacattgctgagacatctctgaccattgatgggatctactatgtggtggatccaggtttt
gtcaagcagaaggtatacaactccaagacgggcatcgaccagctggtggtgacgccgatc
tctcaggcgcaggctaagcagcgggcaggtcgggcggggcggacgggcccggggaaatgc
tacagactgtacacggagcgcgcctaccgagacgagatgctcaccaccaacgtgcctgag
atccagagaactaacttggccagcactgtgctctctctcaaggctatgggcattaatgac
ctgttatcattcgacttcatggacgctccaccgatggagacactgatcacagccatggaa
cagctgtacacactaggggccctggatgacgagggactgctcactcgcctcggacgcagg
atggcggagtttcctctggagcccatgttgtgtaagatgctcatcatgtctgtccacctg
ggttgcagtgaagaaatgctgactattgtgtccatgctctctgtgcagaatgtcttttac
agacctaaggacaaacaggctctggctgaccagaagaaggccaagttccaccagcctgag
ggtgaccacctgaccttattggctgtatacaactcttggaagaacaacaagttctccaat
ccatggtgctacgagaacttcatccaggcacgctccttgcggcgtgcgcaggatatccga
aaacagatgctgggcattatggaccgacacaagttggatgttgtatcgtgtggtaaggcc
acagtgcgtgtacagaaagcaatctgcagtggtttcttccggaatgcagctaagaaagac
ccccaggaaggctataggaccctcatagatcagcaggtggtctacatccacccctccagt
gccctgtttaaccgtcagccagaatgggtggtgtaccatgaactggtgttgaccaccaaa
gaatacatgagggaggtgaccaccatcgatccacgctggctggtagagtttgcgccggcc
ttcttcaaagtgtctgacccaactcgccttagcaagcagaagaaacaacagcgcctggag
cctctctacaaccgctatgaggagcccaatgcttggagaatctccagagctttccgcagg
cgctag

DBGET integrated database retrieval system