KEGG   Electrophorus electricus (electric eel): 113575948Help
Entry
113575948         CDS       T05787                                 

Definition
(RefSeq) ectonucleoside triphosphate diphosphohydrolase 8-like
  KO
K01510  apyrase [EC:3.6.1.5]
Organism
eee  Electrophorus electricus (electric eel)
Pathway
eee00230  Purine metabolism
eee00240  Pyrimidine metabolism
eee01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eee00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    113575948
   00240 Pyrimidine metabolism
    113575948
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:eee04090]
    113575948
Enzymes [BR:eee01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.5  apyrase
     113575948
CD molecules [BR:eee04090]
 Proteins
  113575948
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDA1_CD39
Motif
Other DBs
NCBI-GeneID: 113575948
NCBI-ProteinID: XP_026863598
Position
Unknown
AA seq 498 aa AA seqDB search
MDKPCFKPVLLGITLLAIACMTVIALVLTVAKHQTVDLPYSTQYGIVFDAGSTHTSLFLY
QWPGNKENNTGVVSQKLTCDVKGDGISSYVTNPPDAGQSLKECIDVAMAAIPPSQLSTTP
VYLGATAGMRLLMLENQTQAERILAEVTKAIQSYPFDFRGARILTGMEEGAYGWITINYL
LEGFIKYAFDGRWVHPKSGKIQGALDLGGASAQISFTPKDPVKDPGAAFDLQLYGYRYQL
YTYSYLCYGKDQALKMLQAYLHMAARPSSVVQHPCYHRNYSLTLKLGDLYNSPCVVKQLP
FDPALKVTFLGTGDSQLCLSLMKSIINLTDCSFYPDCGFNGVYQPPVNGEFFAFSAYFYT
FNFLGLAPRTPLPRVLATIESYCNKTWDTLVLEYPKVKETYLRDYCGSAHYIMTILLKGF
KFNDSWDQIYFYKQVEDNDIGWTLGYMLNLTNLISSDRPLVITGVQHSQWAAEVFFIVFV
LFLSILILIVLCAWGPKH
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggacaagccatgcttcaaacctgtgctactgggtattacattgttagcaattgcatgc
atgactgtcattgctctggtcctcactgttgctaaacatcagacagtggatttgccatac
tcaacacagtatgggattgtgtttgatgcgggttccacacacacttccctcttcctgtat
cagtggccagggaacaaggaaaacaacactggagttgtttctcagaaactgacttgtgat
gtgaaaggtgatggcatatccagttatgtcacaaaccctcctgatgcaggacaaagccta
aaagaatgcatagatgttgccatggcagcaataccacccagccagctaagcacaacacct
gtctatctgggagccacagctggcatgcgtcttctcatgttagaaaaccaaactcaggca
gaaaggatactggctgaggtgaccaaagctatccagagttatccctttgattttcgtggg
gccagaattctcactggcatggaggagggggcctatggatggatcaccatcaactatctt
ttggagggcttcattaagtatgcatttgatggtagatgggttcatccaaagtcagggaag
attcaaggagctctggacttgggtggtgcatctgcacaaatttcctttacacccaaggat
ccagttaaagacccaggggctgcatttgacctccagctctatggctacaggtaccagctg
tacacatatagttacctgtgctacggcaaagaccaagccttgaagatgctccaggcgtac
ctgcacatggctgctagaccttcttctgttgtccaacatccctgctatcacaggaattac
agtttgacgctaaaactgggtgacctttacaattctccttgtgtggtcaagcaattgccc
tttgaccctgcattaaaggttactttcctagggactggtgattctcagctctgcctgtca
ttgatgaagagcatcataaacctgactgactgctcattttacccagactgtggctttaat
ggagtctatcagcctccagtcaatggagaattctttgccttttctgcttacttctacacc
tttaatttccttggtcttgctccaaggactccactgcctcgagtccttgccacaattgaa
tcctactgcaacaaaacctgggacacacttgtgttagaatatccaaaagtgaaggaaaca
tatcttcgggattactgtggttcagcacattatatcatgactattctcctcaaaggattt
aagttcaatgatagctgggatcaaatctacttttataaacaggtggaagacaatgacatt
ggttggaccctgggctatatgcttaacctgaccaatctaatttcctctgaccgccctcta
gtgattacaggagtacaacacagccaatgggcagcagaggttttcttcattgtatttgta
ctctttctcagcatattaattctaatcgtcctctgtgcttggggcccaaagcattga

DBGET integrated database retrieval system