KEGG   Electrophorus electricus (electric eel): 113575991Help
Entry
113575991         CDS       T05787                                 

Gene name
espl1
Definition
(RefSeq) separin
  KO
K02365  separase [EC:3.4.22.49]
Organism
eee  Electrophorus electricus (electric eel)
Pathway
eee04110  Cell cycle
eee04114  Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:eee00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    113575991 (espl1)
   04114 Oocyte meiosis
    113575991 (espl1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:eee01002]
    113575991 (espl1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:eee03036]
    113575991 (espl1)
Enzymes [BR:eee01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.49  separase
     113575991 (espl1)
Peptidases [BR:eee01002]
 Cysteine Peptidases
  Family C50: separase family
   113575991 (espl1)
Chromosome and associated proteins [BR:eee03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   Separase
    113575991 (espl1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C50 CHAT TPR_12
Motif
Other DBs
NCBI-GeneID: 113575991
NCBI-ProteinID: XP_026863662
Position
Unknown
AA seq 2196 aa AA seqDB search
MKCLKTDDYLQRILCLKDTVVLHDELKKHVVDGLGQWGRTVCDRIIRACNQRLGAGALEL
EHLECLVDLVELAVRGYGLITEPRTQGCPFYLEKIIFHILQKLVTQGAHGPASRLGEIMY
VKLQGSSTEAEDFRVLVRNCFAVLWNSLLLSGSCGSRASSLPPRERLHWQLQALLFRLLE
DTATPPSSLSKVPLFVEEAVGEYAQACGGLSQDDGVFLLSELRACFLGPSLGEHAIGDSK
LPLPLLAVRCQVVLKMCRLLCKSRLWAEATLLVDSALEMARRISDVLCPPLGLISRAVQL
HCALSSGEECSKIFTDCARVLRGLPAALGDAGCIILEACQLVLWATEMGQAKGMGGTSLL
ACFSFLEEYQELLLKQQQSSFSQQLQYSLCFSLYQGFMSTYDSLRSSQESLGNSLSRVML
YCQATLGCMMNELRKLSNDSFLLKSVCAVNNVVYELFNRKLYKEAFGLAEIVCQELNKDC
PASLPVDRVNRCFMLVVHCSRRAAQLERALDWVVRWIQVLGVRVLDHLAEPVSLWVKTKC
DAARAGEEDARLRTLRDGLGASPVDEEVMVCLLEEELRIYKEQAGDTAQERYNTLCDLLD
ICHEDSTHTLRRASYLCEMAQVVCYQDFSQQTDCTAVDFTHEALRLLEEEPETADNADRL
KDEKAHASLWLFICTLEAHLQEALDIEKRLRAVQEGSKCGGSLEPVPTNDLDYEDKQKLQ
ESQLVYDGLRFNLAEHNKHCEPLDRCLSLWEALLKEGSMPAVRDPKSTASSILLMAALYS
LMAKPLRALQSYQLAATLLQLLGDGQNSASALCHSAKLLLDLGSPQLAQLQLEQAEQSLA
GEADSEGITIMSVTTRLLRAHLCYSLGEVEHGLSSLCDVLKETAQHHSKSWYMLKARALQ
TASIYLSLETSTLPPNLRQTIVQHGVKTPDTAQYEALKLLCSLVMMLLGNGFYGAPGHNV
DTRFVDQGDSVLFKWLLLSEVLLCSERVVCVRSSAGAAHEAKAQCLEALKLATKLHTFTH
CADMLVMKAELELMKGASEVSALDLEQVRNLLDLCTDLGDQQQQKSELKIKPRKGRPAAQ
TSATLAPEDEEEDLRGLLSCRALGREPVEALSELGQEASPPLKPKRQRMLACLTHGEGCS
CACCSEPSLGRVAVRWALAQAHLHDESPNSHRLRYFAKLRCRSITVKLRVHLATLLSTKG
LAGPTPSLLKAELGRAHLGSVLMQLRCGAEEKGKAAALWEEIEAGLEAVEPKGAMYPELA
PLRAALLRAKAEACLLALAGKRQCSSDDLFSSVWGWTPPLTTAAPKVKKQSKPRTEQTHP
KCSSNDKLLPAVGTSAKNLPDGNRVASKEHSTKKTKEVSAASSKKAKDSVPKISNAKHGM
EFKTPRATRTPRPKSTSLVTPALLAGDLSAFDFTSEVPDISTPIPVSKAMPGSRRPARTK
VASKGSFQVFKDSSPQQENTIDVPAAPKRTKRSRFKVDFSDESDGETAPPAVMESETKGS
VSCKTRSAPKPACKVSEEAVAPRRTRVSKQSTALCTSGPSSEDETSVSTQTRSRRQRPRR
GPSSKDLDQPERMRMIKEDEDEDGLDVSLEDLQESETLSGSPTGGPVADFEVLRRDLGAD
LSRDHVNELRSSVQPGLGMHTPLPHTHVAPGELSLDVVKSLLSSSWLLLHHFPSPSLYPH
VCSLLVQLLGLSDPITTAMLHAQSLGVSTRHQMTRHLANRLRKLKKSGGDIATSLSALSL
EESSTQSQAKTLTALESIYSFTSTQPTQFPQTHCQEFTRQLGDLPAGVTVCLLSLVGVCP
GEVGNTILLTRLECDSAPITIRIPTAHTHCSMAALLEEMEAVLQGQKQVSGVADKVQWWE
GRKALDTRVQKLIDKMEEALGVWRALLLPLTSDPELLVQLKCLEPLLTGTKITVDMLKMV
LSAAPLLALSDLQSLAKGVCLLEGDFLKVLQKGVSELRGREEPKGHTVLILDKYLQRLPW
ENIPCLKPRSVTRMPSLHSVLGHSHLQEVDPDSVQSCGVDPKQVYFVLNPDRNLPETEKR
FRDWFTSEPAWQGVCGAPPDPDQLQEAVSTKDLYIYVGHGAGVRFLDAQRLQRGRVRAVV
LLFGCSSAALSMQGCLEGNGIVLSYLIAGCPLVLGNLWDVTDRDIDRFTSALLQSWLSSG
SGSSLFHHLVKSRDATHLKHIIGAAPIAYGLPVHVQ
NT seq 6591 nt NT seq  +upstreamnt  +downstreamnt
atgaaatgtctaaaaacagatgactaccttcaacgaatattgtgtcttaaagacacagtg
gttcttcacgatgagttgaagaaacatgtagttgatggcctcggccaatggggccggacg
gtgtgtgatcgtatcattcgagcatgcaaccagcggcttggtgctggagccttggagctg
gagcatttagagtgtttggtggatctcgtagagctagccgtgcggggctacgggctgatc
acagagcccaggacacagggctgccccttttatctggagaaaataatcttccacatcctg
cagaagttggttactcaaggagctcatggtcctgctagccgacttggggaaatcatgtat
gtcaaactacagggctcatcgacagaggctgaagacttccgtgttctggtgcggaactgt
tttgcagtgctatggaacagtctcctgctttcaggttcttgtggctctcgggcctccagc
ctgcctcccagagagcgactccattggcagctacaggctctgctcttccggctgctggag
gacacggccaccccaccatcctccctgtccaaggtgcctctgtttgtggaggaggcggta
ggcgagtatgcgcaagcctgcgggggcttgtcccaggacgatggcgtgtttttactctct
gagctgcgggcgtgtttccttggcccctcacttggtgagcatgctattggggactccaag
ttgcctctgcccttgctggctgtgaggtgtcaggtggtgttaaagatgtgcaggctcctg
tgtaagagcaggctgtgggcagaggccacgctgctggtggatagcgctctggagatggct
cggcggatcagcgacgttctatgcccacctctaggcctcatcagtagggcagtgcagctg
cactgtgcccttagctctggggaggaatgcagcaagattttcacagactgtgcacgtgtc
ctgagagggctgcctgctgctttgggagatgcaggctgtatcatactggaggcgtgtcag
ttggtcctctgggcaacagagatggggcaagcaaaagggatgggtgggacttcattgctg
gcctgtttttctttcttggaggaatatcaggagcttttgctgaaacagcagcagagttcg
ttctcgcagcagctgcagtattcactgtgcttcagtctgtaccagggcttcatgagcacc
tacgacagccttcgtagctcacaagaatcacttggtaattctctcagcagagttatgtta
tactgccaggcaacgttaggatgtatgatgaatgaactacgcaaattgtcaaatgacagc
ttcttactcaaatcagtgtgtgcggtgaataatgtagtgtatgagttatttaacaggaaa
ttgtataaggaagcatttggactggctgagattgtatgtcaggaattgaataaggactgc
cctgcctctctccctgtggacagagtgaaccgctgcttcatgctggttgtgcattgcagt
cgtcgggcagcccagctggagagggctctagactgggtggtgcgatggattcaggttcta
ggcgtacgggtcctagatcaccttgcggagccagtctcgctgtgggtcaaaaccaagtgt
gatgctgcacgtgcaggagaagaagacgcgcgcctcaggacactgcgtgatggtttggga
gcatcacctgtggatgaggaggtgatggtgtgtctgctggaggaggagctgcgtatatat
aaagaacaggctggtgacacggcacaggaacgctataacactctctgtgacctcctggat
atctgtcatgaagacagcacacacacacttaggcgtgcctcatacctgtgtgagatggca
caggtggtgtgttatcaggacttcagtcagcaaactgactgcactgcagttgattttacc
catgaggctctgcgcttgttggaggaggagccagagacagctgacaatgctgatagactg
aaggatgaaaaggcacacgcctctctctggctcttcatctgcacactcgaagctcacctc
caggaggcgcttgatatagagaagcgtctacgtgcagtgcaggagggcagtaagtgcggt
gggagtttggagccggttcccaccaatgatctggattatgaagacaaacagaaactccag
gagagtcagctggtgtatgacggactccgcttcaacctggcagagcacaataaacattgt
gagcctttggatagatgtttatctctctgggaggcattgctgaaggagggatcgatgcct
gcagtgagagatcccaaaagcactgcctcctccatcttgctgatggctgccctctactca
ctgatggccaagccactgagggctctgcagagctatcagctggctgcgactctgctccaa
ctcctcggtgatggccagaatagtgccagtgcgctctgccactctgccaaactcctgctg
gacttgggatctccccagcttgctcagttgcagctggagcaggcagagcagtccttggct
ggagaagcagactctgagggcatcactatcatgtcagttacaaccagactgctgagagct
catctctgctactctctaggagaggtagagcatggtttgtccagcctgtgtgatgtctta
aaagagacagcacagcatcactctaagagctggtacatgctaaaagctcgagcactacag
acagccagcatctacctcagtctggaaacaagcactctcccgccaaacctgcgccaaacc
atcgtccagcatggtgtgaagactccagacacggcccagtatgaagcgctgaagttgctg
tgcagtctggtgatgatgttgttgggaaatggcttttatggagcacctggtcacaacgtg
gacactcgctttgtcgaccaaggggacagtgtgctgtttaaatggctgttactaagtgag
gtgttgctgtgctctgagagggtggtgtgtgtgaggagtagtgctggggcagctcatgag
gccaaggcccagtgcttggaggctcttaaacttgccactaagctacacaccttcacccac
tgtgctgacatgttggtgatgaaggctgagctggagttgatgaaaggagcaagtgaagtc
agtgctttagatttggaacaggtcagaaacctgctggatctttgcacagaccttggcgat
cagcagcagcagaaatctgagctaaaaataaaacctcgcaaaggccgaccagctgctcag
acctctgccaccctggctcctgaggatgaggaggaagacctccgcggcctcctgagttgt
cgtgcgctgggccgggagcccgtggaagcactgtctgagctaggccaggaagcgtcaccc
cctctgaagcccaagcggcagcgcatgctagcctgcctgacccacggcgagggctgttct
tgtgcctgctgcagtgagcccagcctgggccgcgtggccgtccgctgggccctggcacag
gcacacctccatgacgagtcaccaaactcccatagactacgctacttcgccaagctgcgt
tgtcgtagcattaccgttaagctacgcgtccacctggctaccctcctgtccactaaaggg
ctagctggtcccaccccgtccctgctgaaggctgagcttggcagggcacatctgggctcg
gtgctgatgcagcttcgctgtggggcagaggagaagggcaaggctgctgccctgtgggag
gagattgaggcagggctagaggctgtggaacctaaaggggccatgtatccagagctggcc
cctcttagggcggcccttctcagggctaaggcagaggcctgcctcctggccctagctggg
aaacggcagtgcagctctgatgatctcttctcctccgtgtggggctggaccccaccactg
acaacagctgctcccaaggtcaaaaagcagtccaaacctagaacagaacagacccatcca
aagtgctccagcaatgacaaacttctcccagcagtggggacatctgctaagaacctccct
gatggcaacagagtggcctccaaagagcactctactaagaagaccaaagaagtgtctgct
gcttcctcaaagaaagccaaggactccgtgcctaaaatcagtaatgcaaaacatggcatg
gaatttaaaacgccccgggcaaccaggaccccccgccccaaatctacatccttggtaact
cctgccctcctagctggggacctgagtgcatttgacttcaccagtgaggtgcctgatatc
tccaccccaataccagtctccaaggccatgcctggcagccgcagacctgcaaggacaaag
gttgcttcaaagggctccttccaggtgtttaaagactcttctcctcaacaggagaatacc
atagatgttccagctgcacccaaacggaccaagcgctcacgatttaaggttgactttagt
gatgagagtgatggtgagacggctccccctgctgtgatggagtcagaaacaaagggctct
gtctcatgtaaaacccgttcagcacccaaaccagcctgtaaagtctctgaggaagccgtg
gcacccagaagaacaagggtcagtaagcaaagcacggccctctgcaccagcggcccctcc
tctgaggatgaaacaagtgtgtccacgcaaacccggtcccggcggcaacggcccagaaga
ggtccgagctccaaggacctcgaccaaccagagagaatgaggatgatcaaagaggatgag
gatgaagatggtctagatgtcagcctggaggaccttcaggagtctgagacgctaagtggc
agtccaacaggtggccctgttgctgattttgaggtcctgaggagagacttgggagcagat
ctgagcagagatcatgtgaatgagttgaggagctcggtgcagccgggcttaggcatgcat
actccactaccccacacacacgtggcaccaggtgagctctctctagatgtggtcaagtca
ctcctgtcctcctcttggctcctcctacatcattttccgagcccctccctctatccccat
gtgtgctcattactggttcagttactgggcctttctgatcccatcaccacggcaatgctt
cacgctcagtcactcggagtgtctactcgccatcagatgacccggcaccttgctaatcgg
cttaggaagctgaagaagtctggaggtgacatagcaacgagtctgagtgctctgagtctg
gaggagtcttccacacagtcccaagcaaagacactaactgcactcgagagcatctactcc
tttacttccacccagccaacacagttccctcaaacgcactgccaggagttcacacggcag
ctcggagacctgccagcaggtgtgaccgtgtgcctgctttctcttgtgggcgtatgtcct
ggtgaggttggcaacaccatccttcttacacgactggagtgtgactctgcccccattacc
ataaggatcccaactgcacacactcattgctcgatggctgcactgctggaggagatggaa
gcagtcctgcaggggcaaaagcaagtgagcggcgtggcggataaagtgcagtggtgggag
ggcaggaaggccttggacactcgcgtgcagaaactgattgacaagatggaagaggcttta
ggagtatggcgagctttactgctccccttgacctctgatcctgagcttttggttcaactg
aaatgccttgaacccctactaacaggaacaaagatcactgttgacatgttaaagatggtt
ctgtctgcggctccactacttgccctctcagacctgcagtctctggctaagggagtatgt
ctgctggaaggtgacttcctgaaggtgctacagaagggtgtgtctgaactgagagggagg
gaggagcctaaaggacacacagtcttaattttagacaagtaccttcaaaggttgccatgg
gagaacatcccttgtttgaagcctcgttccgtcactcgtatgccttcactacattctgta
ctgggacacagtcatctccaagaagtggatcctgactctgtgcagtcatgtggtgtagat
cctaagcaggtttattttgttctgaacccagacagaaacctacctgagactgaaaagcgg
ttcagagactggtttactagtgaaccggcctggcagggggtatgtggcgctcctcccgat
cctgatcagctgcaggaggctgtatccacaaaagacttgtacatctatgtgggacatggc
gcaggggtgcgcttcctggatgcccagaggctgcagcgagggcgagtgcgagcagtggtt
ctgctttttgggtgtagcagtgctgcactcagcatgcagggctgcctcgagggaaatggc
attgtcctcagctacctcatcgccggatgtccattggtgttggggaatctgtgggatgtg
acggatcgtgatatagatcgcttcacttctgccctcttgcagtcctggctttctagtggc
tcagggtcctcactgttccatcaccttgtcaaatcccgtgatgccacacacctcaagcac
ataattggagctgcaccaattgcatatggtctgcctgtacatgtgcagtag

DBGET integrated database retrieval system